(data stored in ACNUC1104 zone)

EMBL: CP002417.PE418

CP002417.PE418       Location/Qualifiers
FT   CDS_pept        446117..447610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0419"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="KEGG: vap:Vapar_6042 NAD(P)(+) transhydrogenase
FT                   (AB-specific); PFAM: NAD(P) transhydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34641"
FT                   /db_xref="GOA:E6V3F1"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F1"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADU34641.1"
FT                   /translation="MNLVTLLYLVASVCFIQALKGLSHPTTSIRGNIFGMTGMAIAVLT
FT                   TIALIHGQARSLNVDFGTGLAWVLAAVVVGGGLGAFMANKVEMTKMPELVAFMHSMIGL
FT                   AAVFIGVAAVAEPWAFGITAAPVAALIGAQTPDGAVILDGFVRYAIPAGNRLELFLGAA
FT                   IGAITFSGSVIAFGKLSGKYKFRLFQGAPVQFSGQHMLNLVLGLLTVALGLVFVFTESW
FT                   PAFFAMLALAFVMGVLIIIPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNAMLIVAGSL
FT                   VGSSGAILSYIMCKAMNRSFFNVILGGFGGEAATTGGAAKEQRPVKTGSADDAAFVLGN
FT                   AETVVIVPGYGLAVARAQHAVKELAAKLTEKGITVKYAIHPVAGRMPGHMNVLLAEAEV
FT                   PYDQVFEMEDINGEFGQADVAIILGANDVVNPAAHTKGSPIYGMPILEAYKAKTVIVNK
FT                   RSMAAGYAGLDNELFYMDKTMMVFGDAKKVVEDMGKAIE"
     atgaacctcg tcacgctgct gtacctggtt gccagcgtct gcttcatcca ggccctgaag        60
     ggcctgtccc atcccaccac ctcgatccgc ggcaacatct tcggcatgac cggcatggcg       120
     atcgccgtgc tcacgaccat cgcgctgatc cacggacagg cgcgctcgct caacgtggat       180
     ttcggcaccg gcctcgcctg ggtgctcgcg gccgtggtgg tcggcggggg ccttggggcc       240
     ttcatggcca acaaggtcga gatgaccaag atgcccgagc tggtcgcctt catgcacagc       300
     atgatcggcc tggccgcggt cttcatcggc gtggccgcgg tggccgagcc ctgggccttc       360
     ggcatcaccg ctgcgcccgt ggccgcgctc atcggggcgc agacgccgga cggcgccgtc       420
     atcctggacg gcttcgtgcg ctacgccatt cccgcaggga accggctcga gctcttcctg       480
     ggtgcggcca tcggcgccat caccttcagc ggctcggtca tcgccttcgg caagctctct       540
     ggcaagtaca agttccgcct gttccagggc gcgccggtgc agttctcggg ccagcacatg       600
     ctcaacctgg tgctgggtct cctgaccgtc gcactgggtc tggtgttcgt cttcaccgag       660
     agctggcccg ccttcttcgc gatgctggcg ctggccttcg tgatgggcgt gctcatcatc       720
     atcccgatcg gcggcgccga catgccggtg gtggtgtcga tgctcaacag ttactcgggc       780
     tgggcggccg cgggcatcgg cttcagcctg aacaacgcga tgctgatcgt ggccggttcg       840
     ctggtgggct cctcgggtgc gatcctctcg tacatcatgt gcaaggcgat gaaccgctcg       900
     ttcttcaacg tgatcctggg cggcttcggc ggcgaggctg ccacgaccgg cggcgcggcc       960
     aaggagcagc gcccggtgaa gaccggcagc gccgacgatg cggccttcgt gctcggcaat      1020
     gccgagaccg tggtgatcgt gccgggctac ggcctggccg tggcgcgtgc ccagcatgcg      1080
     gtgaaggagc tcgcggccaa gctcaccgag aagggcatca ccgtcaagta cgccattcac      1140
     ccggtggcgg gccgcatgcc cggccacatg aacgtgctgc tggccgaggc cgaggtgccc      1200
     tacgaccagg tgttcgagat ggaggacatc aacggcgagt tcggccaggc cgacgtggcg      1260
     atcatcctgg gcgccaacga cgtggtgaac ccggccgcgc acaccaaggg cagcccgatc      1320
     tacggcatgc cgatcctgga agcctacaag gccaagaccg tcatcgtgaa caagcgctcc      1380
     atggccgcgg gctatgccgg cttggacaac gaactcttct acatggacaa gaccatgatg      1440
     gtttttgggg atgcgaagaa agtagtggaa gatatgggca aggccatcga atag            1494
//

If you have problems or comments...

PBIL Back to PBIL home page