(data stored in ACNUC1104 zone)

EMBL: CP002417.PE419

CP002417.PE419       Location/Qualifiers
FT   CDS_pept        447720..449399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0420"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   vap:Vapar_0394 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34642"
FT                   /db_xref="GOA:E6V3F2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADU34642.1"
FT                   /translation="MTDRPWLSSYPQGVPADIDASHYSSLVGLMEESFTKYADRTAYSF
FT                   MGKDISYAETDKQSKAFAAYLQGLGLAKGDRVAAMMPNCPQYPIAVAAILRAGLILVNV
FT                   NPLYTPRELEHQLKDSGAKAIVIMENFGTTLQQCIAATPIKHIVLTSMGDRLGFLKGAL
FT                   VNYVVRNVKKMVPHFSLPGAVRFNDALDKGASRTLQAPTIGPDDVAVLQYTGGTTGVSK
FT                   GAVLLHRNVIANVLQSEAWNEPVMAQVPAGEQPTSVCALPLYHIFAFTVGMMLNMRTGG
FT                   KLILIPNPRDLAGVLKELSKHTIHSFPAVNTLFNGLANHPDFNTVNWKNLKVSVGGGMA
FT                   VQAAVAKLWLEKTGCPICEGYGLSETSPSTTCNPTNSKAYTGTIGLPLPGTWLKLLDDD
FT                   GHEVPMGQPGEIAIKGPQVMAGYWQRPDETAKVMTPDGYFKSGDIGVVDERGYFKVVDR
FT                   KKDMILVSGFNVYPNEIEDVVAQIPGVLECAAVGVVDDKTGEAVKLVIVKKDESLTEAQ
FT                   VSEYCRANLTGYKQPRIVEFRTDLPKTPVGKILRRELRDAKK"
     atgaccgacc gcccctggct cagcagctat ccgcaaggcg tgcccgccga catcgacgct        60
     tcgcactatt catcgctggt cgggctcatg gaagagagct tcaccaagta cgccgaccgc       120
     accgcctaca gcttcatggg caaggacata agctacgcgg agaccgacaa gcagagcaag       180
     gccttcgccg cgtacctgca gggcctgggc ctcgccaagg gcgaccgcgt ggccgcgatg       240
     atgcccaact gcccgcagta cccgatcgcg gtggcggcaa tccttcgcgc ggggctgatc       300
     ctggtgaacg tgaatccgct ctacacgccg cgcgaactgg agcaccagct caaggattcg       360
     ggcgccaagg ccatcgtcat catggagaac ttcggcacca cgctgcagca atgcatcgcg       420
     gccacgccga tcaagcacat cgtgctcacc tcgatgggcg accgcctcgg tttcctcaag       480
     ggcgcgctgg tcaactacgt ggtgcgcaac gtcaagaaga tggtgccgca cttcagcctt       540
     ccgggcgccg tgcgcttcaa cgatgcgctc gacaagggcg cgagccgcac gctgcaagcc       600
     ccgaccatcg gccccgacga cgtggccgtg ctgcagtaca ccggcggcac caccggcgtc       660
     tcgaagggtg cggtgctgct gcatcgcaac gtgatcgcca acgtgctgca gtccgaggcc       720
     tggaacgaac ccgtcatggc gcaggtgccg gccggcgagc agcccaccag cgtgtgcgcg       780
     ctgccgctgt atcacatctt cgcgttcacg gtcggcatga tgctgaacat gcgcacgggc       840
     ggaaaactga tcctgatccc gaatccgcgc gacctcgcgg gcgtgctgaa ggagctctcg       900
     aagcacacga tccacagctt ccccgcggtc aacacgctct tcaacggcct ggcgaaccac       960
     cccgacttca acaccgtcaa ctggaagaac ctcaaggtct cggtcggcgg cggcatggcg      1020
     gtgcaggctg cggtcgcgaa gctctggctc gagaaaaccg gctgcccgat ctgcgagggc      1080
     tacggcctct ccgagacctc gccttcgacc acctgcaacc ccacgaacag caaggcctac      1140
     accggcacca tcggcctgcc gctgccgggc acctggctca agctgctcga cgacgacggc      1200
     catgaagtgc cgatgggcca gcccggcgaa atcgccatca agggtccgca ggtgatggcg      1260
     ggctattggc agcgccccga cgaaaccgcc aaggtcatga cgcccgacgg ctacttcaag      1320
     agcggcgaca tcggcgtggt cgacgagcgc ggctacttca aggtggtcga ccgcaagaag      1380
     gacatgatcc tggtgtcggg cttcaacgtg tacccgaacg agatcgagga cgtcgttgca      1440
     cagattccgg gcgtgctcga atgcgcggcg gtgggcgtgg tcgatgacaa gaccggcgag      1500
     gccgtgaagc tcgtgatcgt gaagaaagac gagtcgctca ccgaggcgca ggtgagcgaa      1560
     tactgcagag caaaccttac gggttacaag cagccgcgaa tcgtagagtt tcgtacggac      1620
     ctcccgaaaa cgccggtcgg aaaaatcctc cgccgcgaat tgcgcgacgc caagaagtaa      1680
//

If you have problems or comments...

PBIL Back to PBIL home page