(data stored in SCRATCH zone)

EMBL: CP002417.PE42

CP002417.PE42        Location/Qualifiers
FT   CDS_pept        complement(45219..45695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0042"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pag:PLES_52491 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34265"
FT                   /db_xref="GOA:E6UXS1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADU34265.1"
FT                   /translation="MSSAAPWVLRRADASDAASVAACAIEAFRHYIPRLGLTPIPMTRD
FT                   YGAAIANAQVWVATQQDEVIAALVLDITDEGFLVDVIAVRPAHQGTGVGRALLELAERE
FT                   ALRQGHDSIYLFTNEKMTENRALYERIGYVEYRRLVLAERTRVFLRKPLNKTKD"
     gtgagcagcg ccgcgccttg ggtgctgaga cgggccgatg cgagcgatgc ggcatcggtc        60
     gccgcctgcg ccatcgaggc cttccgccac tacatcccgc gcctcggcct cacgccgatt       120
     ccgatgacca gggactatgg cgccgccatt gcgaacgcgc aggtctgggt cgccacgcag       180
     caggacgaag tcattgccgc gctggtgctc gacatcaccg acgaaggctt tctcgtcgac       240
     gtgattgcag tgcggcccgc gcaccagggc accggcgtcg gccgcgccct gctcgagctt       300
     gcggaacgcg aggcgctgcg gcaaggccac gattcgatct acctcttcac caacgagaag       360
     atgaccgaga accgcgcgct ctacgaacgc atcggctatg tcgaatacag gcgcctcgtg       420
     ctggcggagc gcacacgcgt cttccttcgc aagccgttga acaagacgaa ggattga          477
//

If you have problems or comments...

PBIL Back to PBIL home page