(data stored in ACNUC1104 zone)

EMBL: CP002417.PE421

CP002417.PE421       Location/Qualifiers
FT   CDS_pept        450455..451369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0422"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vap:Vapar_0396
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34644"
FT                   /db_xref="GOA:E6V3F4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADU34644.1"
FT                   /translation="MMNTTSTPTIPTTGASTAPPGPWREFWTAFSANRGAVIGLVTIVV
FT                   LLLVALFAPWIAPHAPNETNSAVFLQPPAWQQGGTWSYLLGTDAIGRDILSRLMYGARL
FT                   SLSIGVAVVALSVVAGVVLGLIAGFFRGVLEIAIMRLMDIVLTLPSLLLAIVIVAILGP
FT                   GLVNAMLAVAIVVLPHYVRITRAAVIAEVSRDYVTAARVSGAGTLRLMFREVLPNCAAP
FT                   LIVQASLGISTAILDAAALGFLGLGAQPPSPEWGTMLADAREFVLRAWWVVTFPGLAIL
FT                   AAVLAFNLLGDGLRDALDPKLKR"
     atgatgaaca cgacttcgac ccccaccatt ccgacgaccg gtgcgagcac cgcgccgccc        60
     ggcccctggc gcgagttctg gaccgccttc tctgcaaacc gcggcgcggt catcgggctc       120
     gtgaccatcg tcgtgctgct gctcgttgcg ttgttcgcac cgtggatcgc gccgcacgcg       180
     cccaacgaaa ccaacagcgc cgtgttcctg cagccgcctg catggcagca gggcggaacg       240
     tggagctacc tgctgggcac cgacgccatc gggcgcgaca tcctgtcgcg cctcatgtac       300
     ggcgcgcggc tctcgctgtc gatcggtgtc gccgtggtgg cgttgtcggt ggtggcgggc       360
     gtggtgctcg ggctcatcgc gggatttttc cgcggcgtgc tcgagatcgc gatcatgcgg       420
     ctcatggaca tcgtgctcac gctgccgagc ttgctgcttg ccatcgtgat cgtcgcgatt       480
     ctcggcccgg ggctcgtcaa cgcgatgctc gcggtggcca tcgtggtgct gccgcattac       540
     gtgcgcatca cgcgcgcggc cgtcatcgcc gaggtctcgc gcgactacgt caccgcggcc       600
     cgcgtgagcg gcgccggcac gctgcgcctg atgttccgcg aggtgctacc caattgcgcg       660
     gcaccgctga tcgtgcaggc ctcgctcggc atctccaccg ccatcctcga tgcggcggcg       720
     ctcggcttcc tcggtctcgg cgcgcagccg ccatcgcccg agtggggaac gatgctggcc       780
     gatgcgcgcg agttcgtgct gcgcgcgtgg tgggtcgtga ccttcccggg tctcgcgatc       840
     ctcgcggccg tgctggcttt caatctgctg ggcgacggtc tgcgcgatgc gctcgacccc       900
     aagctcaagc gctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page