(data stored in ACNUC1104 zone)

EMBL: CP002417.PE422

CP002417.PE422       Location/Qualifiers
FT   CDS_pept        451392..452420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0423"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: vap:Vapar_0397 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34645"
FT                   /db_xref="GOA:E6V3F5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F5"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADU34645.1"
FT                   /translation="MPLLDIKDLHVEFPTQGGVLHAVDGVSLTLEEGEVLGIVGESGSG
FT                   KSVTMMALMGLVGFPGRVRAEHMRFAGKDLLGISDKARRSLVGKEVAMIFQEPTTSLNP
FT                   CFTIGFQLMETLRLHLNLDKRTAKKRATELLEQVGIPAASSRLASYPHQLSGGMNQRVM
FT                   IAMAIACNPRLLIADEPTTALDVTIQAQILDLLRDLQKERGMALVLITHNMGVVSEMAQ
FT                   RIAVMYAGQVMEHQRVDRLFASPQHPYTEALLAALPERAAPEGRLATISGVVPGVHDRP
FT                   LGCLFAPRCSYVTTRACNVRPALREWQGAEVRCHYPLGEPGRIVAIEQDRPQQVPAAEV
FT                   LQ"
     atgcctttgc tggacatcaa agatctgcac gtggaatttc ccacgcaggg tggcgtgctg        60
     cacgccgtcg atggcgtgag cctcacgctc gaagaaggcg aggtgctcgg catcgtcggc       120
     gaatcgggct cgggcaaaag cgtcaccatg atggcgctca tgggcctggt cggcttcccc       180
     ggccgcgtgc gcgcggagca catgcgcttc gcgggaaaag acctgctcgg catctccgac       240
     aaggctcgcc gttcgctggt cggcaaggag gtcgcgatga tcttccagga gccgaccacc       300
     agcctcaacc cctgcttcac catcggcttc cagctcatgg aaacgctgcg gctgcacctg       360
     aacctcgaca agcgcaccgc gaagaagcgc gcgaccgaac tgctggagca ggtcggcatt       420
     cccgccgcgt cgtcgcgcct cgcaagctac ccgcaccagc tctcgggcgg catgaaccag       480
     cgcgtgatga tcgcaatggc gatcgcctgc aacccgcgcc tgctgatcgc cgacgagccg       540
     accaccgcgc tcgacgtgac gatccaggcg cagatcctcg acctgctgcg cgacctgcag       600
     aaggagcgcg gcatggcgct ggtgctcatc acgcacaaca tgggcgtggt gagcgagatg       660
     gcgcagcgca tcgccgtcat gtatgcgggc caggtgatgg agcaccagcg cgtcgaccgg       720
     ctcttcgcat cgccgcagca cccctacacc gaagcactgc tcgcggcatt gcccgagcga       780
     gcggcgcccg aaggacggct tgccaccatc agcggcgtgg tgcccggcgt gcacgaccgg       840
     cctttgggct gcctgttcgc gccgcgctgc agctatgtca ccacgcgcgc ctgcaacgtg       900
     cgccccgcat tgcgcgagtg gcagggcgcg gaggtgcgct gccactatcc gctcggcgaa       960
     ccgggtcgca tcgtggccat cgagcaagac cggccgcagc aggtgcccgc ggcggaggtg      1020
     ctgcaatga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page