(data stored in SCRATCH zone)

EMBL: CP002417.PE424

CP002417.PE424       Location/Qualifiers
FT   CDS_pept        453500..455131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0425"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: vap:Vapar_0399 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34647"
FT                   /db_xref="GOA:E6V3F7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADU34647.1"
FT                   /translation="MKTQSSVSRRSRMLALLAPTALAALTLAAGAVSAKTLVYCSEGSP
FT                   ENFYPGMNTTGTSFDVTTQVYNTIVEFERGGTKVMPGLAEKWDISPDGTVYTFHLRKGV
FT                   KWHTTSKSFKPTRDFNADDFIFMLERQWKESDPFFKVTSQNHSYFNDMGMPKLLKSVDR
FT                   IDDFTVKITLNQAEAPFLANLAMQYAGIQSKEYAIAMLKAGTPEKVDQDPIGTGPFYLV
FT                   QYQKDAIIRFKAFPQYWGGKAKIDDLVFAITPDASVRWAKLQKGECHVMPYPNPADLDA
FT                   IRKDPNVQVLEQPGLNVGYLSYNTTKKPFDDVRVRKAINMAINKKAIIDGVYLTTGVAA
FT                   KNPIPPTMWSYNDAIKDDPYDPEAAKKLLAQAGFPDGFSTDLWAMPVQRPYNPNAKRIA
FT                   ELMQADLAKINVKAEIKSFEWGEYRKRLQAGEHQMGMLGWTGDNGDPDNFMYTLLGCAS
FT                   AKSASGSNISKFCYQPYEDLVVKAKSTVKQADRDALYKKAQVIFKEQAPWFTIAHAVQL
FT                   KPVRKEVIDFKLSPFGRHTFYGVDIK"
     atgaagaccc aatcctccgt ttcgcgccgc tcacgaatgc tggcgctcct ggcaccgaca        60
     gcgcttgcgg cccttaccct ggccgcgggt gctgtgtcag ccaagacgct ggtgtattgc       120
     tccgaaggaa gcccggagaa tttctatccg ggcatgaaca ccaccggcac gtcgttcgac       180
     gtgaccacgc aggtctacaa caccatcgtc gagttcgagc gcggcggcac caaggtcatg       240
     ccgggactcg ctgaaaagtg ggacatctcg cccgacggca cggtctacac ctttcatctc       300
     cgcaagggcg tgaagtggca caccacgagc aagagcttca agcccacgcg cgacttcaac       360
     gccgacgact tcatcttcat gctcgagcgc cagtggaagg agagcgatcc gttcttcaag       420
     gtcacgagcc agaaccactc gtacttcaac gacatgggca tgcccaagct cctgaagtcg       480
     gtggaccgca tcgatgattt cacggtgaag atcacgctca accaggccga ggcgccgttc       540
     ctcgccaacc tggcgatgca gtacgcgggc atccagtcga aggagtacgc gatcgcgatg       600
     ctgaaggccg gcacgcccga gaaggtcgac caggacccga tcggcaccgg cccgttctac       660
     ctcgtgcagt accagaagga cgcgatcatc cgcttcaagg ccttcccgca gtactggggc       720
     ggcaaggcga agatcgacga cctcgtgttc gcgatcacgc ccgatgcgtc ggtgcgctgg       780
     gccaagctgc agaagggcga atgccacgtc atgccgtacc cgaacccagc cgacctcgac       840
     gcgatccgca aggacccgaa cgtgcaggtg ctggagcagc cgggcctgaa cgtgggctac       900
     ctctcgtaca acacgacgaa gaagcctttc gacgatgtgc gcgtgcgcaa ggccatcaac       960
     atggcgatca acaagaaggc gatcatcgac ggcgtctacc tcacgactgg cgttgcggcg      1020
     aagaacccga ttccgccgac catgtggtcc tacaacgatg cgatcaagga cgatccgtac      1080
     gaccccgaag ccgcgaagaa gctcttggcg caggccgggt tccccgacgg tttctcgacc      1140
     gacctgtggg ccatgccggt gcagcgcccg tacaacccga acgccaagcg catcgccgag      1200
     ctgatgcagg ccgacctcgc caagatcaac gtcaaggccg agatcaagag tttcgaatgg      1260
     ggcgagtacc gtaagcgcct gcaggccggc gagcaccaga tgggcatgct gggctggacc      1320
     ggcgacaacg gcgatccgga caacttcatg tacacgctcc tgggctgcgc ctcggccaag      1380
     tcggcgagcg gcagcaacat ctcgaagttc tgctaccagc cgtatgaaga cctcgtggtg      1440
     aaggccaaga gcaccgtgaa gcaagccgac cgcgacgcgc tctacaagaa ggcgcaggtc      1500
     atcttcaagg agcaggcgcc gtggttcacc atcgcgcacg ctgtgcaact caagcccgtg      1560
     cgcaaggaag tgatcgactt caagctgagc ccgttcggcc gccacacctt ctacggcgtg      1620
     gacatcaagt aa                                                          1632
//

If you have problems or comments...

PBIL Back to PBIL home page