(data stored in ACNUC1104 zone)

EMBL: CP002417.PE426

CP002417.PE426       Location/Qualifiers
FT   CDS_pept        456044..457498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0427"
FT                   /product="Kelch repeat type 1-containing protein"
FT                   /note="PFAM: Kelch repeat type 1-containing protein; Kelch
FT                   repeat type 2-containing protein; KEGG: geo:Geob_1618 NHL
FT                   repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34649"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR037293"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3F9"
FT                   /inference="protein motif:PFAM:PF01344"
FT                   /protein_id="ADU34649.1"
FT                   /translation="MRGVLGALSAVLFCSLLLAGCGGGGGGGGFPFNLGGNTPEIKDFA
FT                   IGGGVTGISPGGQIVLKNNGGDPLTLSADGPFSFKQRIREGANYTVSVSSTLPTQACTV
FT                   VFASGVATADVASVKVVCGPAQEAVFQPAAAMLTPRVEHTLIALPDGTVLALGGQDLGL
FT                   KGVTSIERYDPASNLWKSAGTLPFQSLQAAVFLPSSGKVLVVGTGAGSQLYDPATQAFT
FT                   PSGGFVTLATVRQLILLLDGRVLASDGNLVELYRPDTGVWRASATASMDHQGGAFTLMA
FT                   NGKILVSGGLLGGTIADSEVFDPSTEKWTTVGRLATSRSGHRGVLLSTGKVLAVGGATG
FT                   TVAHACSCGLRTVAQAELFDPSTNMWSSAGSLLVGRNGFSSTLMPTGRVLVAGGSIQGE
FT                   IDQSTQGFRRTIPSPLSNVEVYDPLTNMWQSWGTLLAARSGHSASLMSSGKLLLSGGSA
FT                   ANPDNPTNPDPYAWHIEFVTSSEIGW"
     atgcgaggag ttctgggagc gctttccgcc gttttgttct gcagcctgtt gctggcggga        60
     tgcggtggag gtggaggtgg aggtggtttt ccattcaacc tgggtggaaa tacccccgaa       120
     atcaaggatt tcgccatcgg tggcggagtc actggcattt cccccggcgg gcaaatcgtg       180
     ttgaagaaca acggagggga tccgctgacg ctgtccgccg atgggccgtt cagcttcaag       240
     caacgcatac gcgagggcgc gaactacacc gtctcggtgt cctccacgct gccgactcag       300
     gcctgcacgg tcgtctttgc cagcggcgtc gccacggcgg acgtcgcaag cgtgaaggtc       360
     gtttgcgggc cggcgcagga agcggtgttt cagccggcag cggccatgct cacgccgcgc       420
     gtggaacata cgttgatcgc attgcctgat ggaacagtgc ttgccctggg agggcaggat       480
     ctgggcctca aaggtgtcac ttccatcgag cgatacgacc cggcgtcgaa tctctggaag       540
     tccgccggga ccttgccgtt tcagagcctg caggccgcgg tcttcctgcc ttccagcggg       600
     aaggtcctgg tggttggaac aggtgcggga tcgcaactct atgacccggc tacgcaggca       660
     tttacgccca gtgggggctt cgtgacattg gcaaccgtgc ggcaactcat tttgctgctc       720
     gatggccgag tgctcgcgtc tgatggcaat ctcgtcgagt tgtaccgccc cgatacaggc       780
     gtttggcggg caagcgccac ggcctcgatg gatcaccagg gcggtgcatt cacgttgatg       840
     gcgaatggga agattctcgt ttcgggtggc ctgctcggag gcaccattgc cgacagtgaa       900
     gtgttcgatc cttccaccga aaagtggacc acggtcggac ggctggcaac ttcccgctcg       960
     ggccatcgcg gcgtactgct ttccacaggg aaagtgctcg ctgtcggggg cgcgactgga      1020
     acggttgcgc acgcctgctc ctgtggcctc aggaccgttg cgcaggctga gttgtttgat      1080
     ccttccacca acatgtggtc gtcggcaggc agtctgctcg tcggtcggaa tggtttctcg      1140
     tcgacgttga tgccgacagg gcgggtgctc gtcgccggtg ggagcattca gggtgagatc      1200
     gatcaatcga cgcaggggtt tcgcagaacg atcccctccc cactgagcaa cgtcgaggtc      1260
     tacgatccgc tgacgaacat gtggcagtcg tgggggacgt tgctggcagc tcgctccggg      1320
     cattcggctt cgctcatgtc cagcgggaag ctgctgttat ctggcggttc ggcagcaaac      1380
     cccgataacc cgacgaaccc agatccctac gcatggcaca tcgaattcgt gacctccagt      1440
     gaaatcggct ggtag                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page