(data stored in ACNUC1104 zone)

EMBL: CP002417.PE427

CP002417.PE427       Location/Qualifiers
FT   CDS_pept        complement(457539..458525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0428"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="KEGG: vap:Vapar_0401 magnesium and cobalt transport
FT                   protein CorA; TIGRFAM: magnesium and cobalt transport
FT                   protein CorA; PFAM: Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34650"
FT                   /db_xref="GOA:E6V3G0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G0"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ADU34650.1"
FT                   /translation="MLNIFTLANGRLVQEEIESLEELSKFQPIWVDLESPTLEEKRWIK
FT                   QYYGLSIPEDAMDEDIEESARFYEEDNGELHIRSDFLIDDDEDPRTVRVAFILNQHNTD
FT                   LRSRGVLFSIHDEDVPVFRLLRMRARRAPGLIEDAKEVMLKLFDADAEYSADTLENIYD
FT                   ELEVAGKKVLSGNVTDELAGEVLGLIARQEDLNGRIRRNVMDTRRAVSFMMRSKMLNAE
FT                   QFEEARQILRDIESLDNHTAFLFDKINFLMDATVGFININQNKTIKIFSVASVALLPPT
FT                   LIASIYGMNFKFMPELDWAMGYPYAIVLMAASALVPMWYFRRRGWLK"
     atgctcaaca tctttacgct cgccaacggc cgcctcgtcc aggaagagat cgagtcgctg        60
     gaagagctct ccaagttcca gccgatctgg gtcgacctcg aatcgcccac gctcgaagaa       120
     aagcgctgga tcaagcagta ctacggcctc tcgattcccg aagacgcgat ggacgaggac       180
     atcgaggagt ccgcccgctt ctacgaggaa gacaacggcg agctgcacat ccgttccgac       240
     ttcctgatcg acgacgacga agacccgcgc accgtgcgtg tggccttcat cctcaaccag       300
     cacaacaccg atctgcgcag ccgcggcgtt ctgttctcga tccacgacga agacgtgccc       360
     gtgttccgcc tgctgcgcat gcgcgcacgc cgcgcgccgg ggctgatcga agacgccaaa       420
     gaagtgatgc tcaagctctt cgacgccgac gccgaatact cggccgacac gctggagaac       480
     atctacgacg agctcgaagt ggcgggcaag aaagtgctct cgggcaacgt caccgacgag       540
     ctggccggcg aggtgctcgg cctcatcgcg cgacaggaag acttgaacgg ccgcatccgc       600
     cgcaatgtga tggacacccg ccgcgcggtg agcttcatga tgcgcagcaa gatgctcaac       660
     gccgagcagt tcgaagaggc ccggcagatc ctgcgcgaca tcgaatcgct ggacaaccac       720
     acggccttcc tcttcgacaa gatcaacttc ctgatggatg cgaccgtcgg tttcatcaac       780
     atcaaccaga acaagaccat caagatcttc tcggtggcga gcgtcgcgct cttgccgccc       840
     acgctgatcg cgagcatcta cggcatgaac ttcaagttca tgcccgagct cgactgggcc       900
     atgggctatc cgtatgccat cgtgctgatg gcggcgagcg cgctggtgcc gatgtggtac       960
     ttccgccggc gcggctggct caagtag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page