(data stored in ACNUC1104 zone)

EMBL: CP002417.PE428

CP002417.PE428       Location/Qualifiers
FT   CDS_pept        458738..460855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0429"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: vap:Vapar_0402
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34651"
FT                   /db_xref="GOA:E6V3G1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G1"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADU34651.1"
FT                   /translation="MQTAAPPVISAAPKTQAERLAAALATLNDDQRAAVEHGVGAAVAD
FT                   DHRPLLVIAGAGSGKTSTLAHRVAHLIADGVDPQRLLLLTFSRRAAQEMERRAGQVLAK
FT                   VLGLKSERPPALPWAGTFHGIGARLLREYAQQIGLDENFTIHDRGDAEDLMGLVRHELG
FT                   LSSTVNRFPRKGTCLSIYSRCVNTRASVAEVLKEAFPWCGEWEAELKTLFGAYVEAKQQ
FT                   QNVLDYDDLLLYWAEMVAEPALAEAVGARFDHVLVDEYQDTNLLQASILLAMKPDGRGV
FT                   TVVGDDAQSIYSFRGATVRNILDFPSQFSREARVVTLERNYRSTQPILDVSNRVIAQAA
FT                   ERHAKTLWTDKPSAGKPQLVLVPDEAGQARWVADKVLAHREGGLALKSQAVLFRTSSHS
FT                   AALELELARRNIPFVKFGGLKFLEASHVKDLLAVLRFAENPRGRMAGFRVTQLIPGIGP
FT                   VTGTRLLDAMDQAADPAAAVRDFVPPSAAREQWAGFAEAYAALRAPSLAWPADVELAMG
FT                   WYLPHLERLYDDTSGVRRQDVEQLVRLAAGYGSRERFLTELTLDPPEATSDRPGPPLLD
FT                   EDYLILSTIHSAKGQEWNSVHVLNVVDGCLPADVAQSAHELEEERRLLYVAMTRARDHL
FT                   HLLVPQRFYITQQAVRGDRHLYANRTRFITESDLAGFEQQTWPPPPVQPPAVPPPAAVI
FT                   DLRNRMRAAWR"
     atgcagaccg ctgcgccccc cgtaatttcc gctgcgccga agacgcaagc cgagcgcctt        60
     gccgcggcgt tggccacgct caacgacgac cagcgcgcag ccgtcgagca cggcgtcggc       120
     gctgcggtgg ccgacgatca ccgcccgctg ctggtgattg ccggtgccgg ttccggcaag       180
     accagcacgc tggcgcatcg ggtggcgcac ctgatcgcgg acggggtcga tccgcagcgc       240
     ctgctgctgc tgactttctc gcgccgcgcc gcgcaggaaa tggagcgccg cgcgggccag       300
     gtgctggcca aggtgctcgg cctcaagtcg gaacgcccgc ccgcgctgcc gtgggccggc       360
     acctttcacg gcatcggggc gcggctcttg cgcgagtacg cgcaacagat cggactcgac       420
     gagaacttca cgatccatga ccgcggcgat gccgaagacc tgatggggct ggtgcgccac       480
     gagctgggcc tgtcttccac ggtcaaccgc ttcccgcgca agggcacgtg cctctcgatc       540
     tattcgcgct gcgtgaacac gcgcgcctcg gtggccgagg tgctgaagga ggccttcccc       600
     tggtgcggcg aatgggaggc cgagctcaag acgctgttcg gcgcctacgt cgaagccaag       660
     cagcagcaga acgtgctcga ctacgacgac ctgctgctct actgggccga gatggtcgcc       720
     gagcccgcgc tggccgaagc cgtgggcgcg cgcttcgacc atgtgctggt cgacgagtac       780
     caggacacca acctgctgca ggcttcgatc ctgctggcga tgaagcccga tgggcgcggc       840
     gtcacggtgg tgggggacga cgcgcaatcg atctactcgt tccgcggcgc gacggtgcgc       900
     aacatcctcg atttcccttc gcagttcagt cgggaggcga gggtggtcac gctggagcgc       960
     aactaccgct cgacgcagcc gatcctcgac gtatcgaacc gcgtgatcgc gcaggcggcc      1020
     gagcggcatg ccaagacgct ctggaccgac aagccctccg ccggcaagcc gcaactggtg      1080
     ctggtgcccg acgaggccgg gcaggcgcgc tgggtggccg acaaggtgct cgcgcaccgc      1140
     gagggcgggc ttgcgctcaa gtcgcaggcg gtgctgtttc gcacctcgtc gcacagcgcg      1200
     gcgctcgaac tggaactggc acgccgcaac atccccttcg tgaagttcgg cgggctcaag      1260
     tttctcgagg cttcgcatgt gaaggacctg cttgccgtgc tgcggtttgc cgagaacccg      1320
     cgcgggcgca tggcggggtt tcgcgtcacg cagctgattc ccggcatcgg gcccgtcacc      1380
     ggcacgcgct tgctcgatgc gatggaccag gcggccgatc cggccgcggc cgtgcgcgac      1440
     ttcgtgccgc cgtccgcggc acgcgagcag tgggccgggt tcgccgaggc ctacgccgcg      1500
     ttgcgtgcgc cgtcgctggc gtggccggcc gatgtggagc tggcgatggg ctggtatctg      1560
     ccgcacctgg agcggctcta cgacgacacc tccggcgtgc gccgccagga cgtggagcaa      1620
     ctggtgcgcc tcgccgcggg ctacggttcg cgtgagcgct tcctgaccga gctcacgctc      1680
     gatccgcccg aagccacgag cgatcgcccg gggccgccgc tgctcgacga ggactacctg      1740
     atcctctcca ccatccattc ggccaagggc caggaatgga actcggtaca tgtgctcaac      1800
     gtggtcgacg gctgcctgcc ggccgacgtg gcgcagagcg cgcacgaact cgaggaagag      1860
     cggcgcctgc tctacgtcgc gatgacgcgg gcccgcgacc atctgcacct cctggtgccg      1920
     cagcgcttct acatcacgca gcaggcggtg cggggcgacc ggcatctgta tgcgaatcgc      1980
     acgcgcttca tcacggaatc ggatctcgct ggcttcgagc agcagacctg gccaccaccg      2040
     ccggttcagc cgcccgcggt gcctccgccc gccgcggtga tcgacctgcg caaccgcatg      2100
     cgcgcggcct ggcgctga                                                    2118
//

If you have problems or comments...

PBIL Back to PBIL home page