(data stored in SCRATCH zone)

EMBL: CP002417.PE430

CP002417.PE430       Location/Qualifiers
FT   CDS_pept        461728..462195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0431"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: vap:Vapar_0404
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34653"
FT                   /db_xref="GOA:E6V3G3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G3"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADU34653.1"
FT                   /translation="MNRLASILPPAQVLVSVDATSKKRAFEEAGLLFESLHGLGRALIT
FT                   DSLFARERLGSTGLGHGVAIPHGRIKGLKAPMAAVFQLANPIGFDAPDEQPVALLIFLL
FT                   VPEAATQKHLEILSEIAELLSDAGLREQIKSSTDATALHGLIAGWQSTQVA"
     atgaatcgcc tcgcgtccat cctgccgccc gcccaagtgc ttgtgagcgt tgacgctacc        60
     agcaagaaac gtgctttcga agaagctggc cttctgttcg aaagcctcca tggcctgggg       120
     cgcgccctca tcaccgacag cctctttgcg cgcgagcgcc tcggctccac cggcctgggc       180
     cacggcgttg ccattccgca tggccgcatc aagggcctca aggcgccgat ggccgcggtg       240
     ttccagctgg cgaatcccat cggcttcgac gctcccgacg agcaacccgt cgcgctcctg       300
     atctttttgc tggtgcccga agcggccacg cagaagcacc tcgaaatcct ctccgaaatc       360
     gccgaactgc tgagcgacgc cggcctgcgc gagcaaatca agtccagcac cgatgccacc       420
     gcgctccacg gcctgatcgc cggctggcag tcgacccaag tcgcctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page