(data stored in ACNUC1104 zone)

EMBL: CP002417.PE433

CP002417.PE433       Location/Qualifiers
FT   CDS_pept        463871..464428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0434"
FT                   /product="SmpA/OmlA domain-containing protein"
FT                   /note="PFAM: SmpA/OmlA domain-containing protein; KEGG:
FT                   vap:Vapar_0407 SmpA/OmlA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34656"
FT                   /db_xref="GOA:E6V3G6"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G6"
FT                   /inference="protein motif:PFAM:PF04355"
FT                   /protein_id="ADU34656.1"
FT                   /translation="MLAIFQRRSWLLAAAVAATLCLGACSGFSDRTRGALAAVTPYKVE
FT                   VVQGNFVSKEQVAALKPGMSRQQVREILGTSLLNDVFHANRWDYVFTIRRQGVEPQERH
FT                   LTVFFNGELMDRFVGDEMPSEEEFVATLDTRKKTGKVPPLEATEDELKKFAPAKDGKAD
FT                   ASASATTVPPLPAAYPPLEAAR"
     atgcttgcca ttttccaacg ccgttcctgg ctgctggctg ctgccgtcgc cgcgacgctc        60
     tgcctcggtg cctgcagcgg tttcagcgat cgcacgcgtg gcgcgctggc cgcggtcacg       120
     ccctacaagg tcgaagtggt ccagggcaat ttcgtgtcga aggagcaggt cgcggcgctc       180
     aagcccggca tgtcgcgcca gcaggtgcgt gaaatcctcg gtacttcgct gctgaacgac       240
     gtgttccatg ccaatcgctg ggactacgtg ttcaccatcc gccgccaggg cgtcgaaccc       300
     caggagcgcc acctgaccgt gttcttcaac ggcgagctga tggaccgctt cgtaggcgac       360
     gagatgccca gcgaagaaga attcgtcgcc acgctcgaca cccgcaagaa aaccggcaag       420
     gtgcccccgc tcgaagccac ggaagacgag ctcaagaaat tcgcgccggc caaggacggg       480
     aaagccgatg cctccgcctc ggcaacgacc gtgcccccgc tgccggccgc ctacccaccg       540
     ctcgaagccg cgcgctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page