(data stored in SCRATCH zone)

EMBL: CP002417.PE434

CP002417.PE434       Location/Qualifiers
FT   CDS_pept        464528..465370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0435"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="PFAM: dihydrodipicolinate reductase; manually
FT                   curated; KEGG: vap:Vapar_0408 dihydrodipicolinate
FT                   reductase; TIGRFAM: dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34657"
FT                   /db_xref="GOA:E6V3G7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G7"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ADU34657.1"
FT                   /translation="MTQPTSSSPSATSVPRRIAIAGASGRMGHMLIEAVRNAPDCRLAG
FT                   ALDIAGSEAIGNDAAAFLGFTSGVPIVADLRTGLKDAQVLIDFTRPEGTLAHLAVCREL
FT                   GVQAVIGTTGFSDAQKAEIAEIAKDVAIMLAPNMSVGVNVTFKLLEMAAKAMSTGYDIE
FT                   IIEAHHRHKVDAPSGTALKMGEVIADALGRDLKDCAVYAREGITGERDPSTIGFSAIRG
FT                   GDIVGDHTVLFAGIGERIEITHKSSSRVTYAQGALRAVRFLAEQKSGLFDMYDVLGLR"
     gtgactcaac ctacctcttc ctccccctcc gccacctccg tgcctcgccg catcgccatc        60
     gctggcgctt cgggccgcat gggccacatg ctgatcgagg ccgtgcgcaa tgcgcctgac       120
     tgccgcctgg ccggtgccct cgacatcgcc ggcagcgaag ccatcggcaa cgatgccgcc       180
     gctttcctcg gcttcacgag cggcgtgccc atcgtggcgg acctgcgcac gggtctcaaa       240
     gacgcgcagg tgctcatcga cttcacccgc cccgaaggca cgctcgcgca cctcgcggtc       300
     tgccgcgagc tcggcgtgca ggccgtcatc ggcaccaccg gcttcagcga cgcgcagaag       360
     gcagaaatcg ccgagatcgc gaaagacgtg gccatcatgc tggcccccaa catgagcgtg       420
     ggcgtcaacg tcaccttcaa gctgctcgag atggccgcca aggcgatgtc gaccggttac       480
     gacatcgaga tcatcgaggc ccaccaccgc cacaaggtcg acgcgccctc gggcaccgcg       540
     ctcaagatgg gcgaagtcat tgccgacgcg ctgggccgtg atctcaagga ctgcgccgtc       600
     tacgcccgcg aaggcatcac gggcgagcgc gatccgtcga ccatcggctt ctcggccatc       660
     cgcggcggcg acatcgtcgg cgaccacacc gtgctgttcg cgggcatcgg cgagcgcatc       720
     gagatcacgc acaagtcgtc gagccgcgtg acctacgcgc agggcgccct gcgcgcggtg       780
     cgcttcctgg ccgagcagaa gtccggcctg ttcgacatgt acgacgtgct cggtctacgt       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page