(data stored in ACNUC1104 zone)

EMBL: CP002417.PE435

CP002417.PE435       Location/Qualifiers
FT   CDS_pept        465382..466077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0436"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   vap:Vapar_0409 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34658"
FT                   /db_xref="GOA:E6V3G8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:E6V3G8"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADU34658.1"
FT                   /translation="MSVLELLTHGDGVSRSVAALLLAMSIASWVVILWKTWLLRGGTRD
FT                   VLRSIAAFWQSATLADAEQKLQAFDRAALVLPAVVAIKNAAAVNVNGTLGATADRNQRL
FT                   TRVLRDALHGALRRLQAGQILLATVGATAPFVGLLGTVWGIYGALTGIAGQTGGFTIDK
FT                   VAGPVGEALVMTAFGLAVAIPAVLAYNVFGRVIGRIEAELEGFAHDLLGSFGAAPAPVA
FT                   PPPARPMPV"
     atgagcgtcc tcgaactgct gacccatggc gacggcgtca gccgctcggt ggcggcgctc        60
     ttgctggcga tgtcgatcgc gagctgggtc gtgattctct ggaagacgtg gctgctgcgc       120
     ggcggcacgc gcgatgtgct gcgcagcatc gcggcgttct ggcagtcggc cacgctggcc       180
     gatgccgagc agaagctcca ggccttcgac cgcgcggcgc tggtcttgcc cgcggtcgtt       240
     gccatcaaga atgcggcggc cgtcaacgtc aatggaacgc tgggcgccac ggccgatcgc       300
     aaccagcgtc tcacgcgcgt gctgcgcgat gccttgcacg gcgcattgcg gcgcctgcag       360
     gccgggcaga ttcttcttgc cactgtcggc gccacggcgc ccttcgtcgg gttgctcggc       420
     acggtctggg gcatctacgg cgcgctgacg ggcatcgcgg gccagaccgg cggcttcact       480
     atcgacaagg tggccggccc cgtcggcgaa gcgctcgtca tgaccgcctt cggtctggcg       540
     gtcgccattc cggccgtgtt ggcctacaac gtcttcggac gcgtcatcgg ccgcatcgaa       600
     gccgagctcg aaggcttcgc gcacgacctg ctcggcagct tcggcgcggc gcccgcgccc       660
     gttgcaccgc cgcccgcgcg gccgatgccg gtctag                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page