(data stored in ACNUC1104 zone)

EMBL: CP002417.PE438

CP002417.PE438       Location/Qualifiers
FT   CDS_pept        complement(469221..470699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0439"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   KEGG: vap:Vapar_0412 glycogen/starch synthase, ADP-glucose
FT                   type; PFAM: Starch synthase catalytic domain-containing
FT                   protein; glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34661"
FT                   /db_xref="GOA:E6V4B5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B5"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ADU34661.1"
FT                   /translation="MRILQVSAELFPLLKTGGLADVAGALPLALMAAGQDARVLLPGFP
FT                   AIVAGVRDLAPVAELTAPWGSERFALRAGHIAIDGAPPIPAYVIDAPALYDRPGNPYED
FT                   ATRQPYGDNHRRFALLGWAAAQLAQGLDPAWRPEVVHAHDWHAGLAPAYLHFAREAGST
FT                   RAGSVFTVHNLAYQGISAPWNFADLGLPAPAFHMNGLEYHGQVSFMKAGLYFADRITTV
FT                   SPTYAREIQTPEQGCGLDGLLRQRSGALTGILNAVDDKVWNPAADAALVQGYHSPEGRH
FT                   MAGKARCKAVLQHQLGLAERPDAPLFILVSRLTEQKGLHLVLGGIDALLAQGGQLALLG
FT                   SGEAWLEEAFRQRAAAAPQSVSVTIGYNETLAHQLFGGGDVTLVPSLFEPCGLTQMYGL
FT                   KYGSLPLVRRVGGLADTVVDSTLEDMASGEATGFVFDRFDAADYERALRRAFALYERAP
FT                   DWRRVRGNAMRRPADWATAAAQYIDVYRQAQAPT"
     atgcgaatcc tccaggtcag cgccgaactc tttcccctcc tcaagaccgg cggcctggcg        60
     gatgtcgccg gcgccctgcc cctcgcgctc atggccgcgg ggcaggacgc ccgcgtgctg       120
     ctgccgggtt ttccggccat cgtggccggc gtgcgcgacc tggcgccggt ggccgagctc       180
     accgcgccct ggggcagcga gcgcttcgcg ctgcgcgcgg ggcacatcgc catcgacggt       240
     gcgccgccga tacccgccta cgtgatcgat gcgccggcgc tatacgaccg gcccggcaat       300
     ccctacgaag acgccacgcg ccagccctac ggcgacaacc accggcgctt cgcgctgctc       360
     ggctgggcgg cggcgcaact cgcgcaagga ctggacccgg cgtggcggcc cgaggtcgtg       420
     cacgcgcacg actggcacgc gggcctggcg ccggcctacc tgcacttcgc gcgcgaagcc       480
     ggctcgacgc gcgccggcag cgtgttcacc gtgcacaacc tcgcctacca gggcatttcc       540
     gcgccctgga actttgccga cctcggcttg cccgcgcctg ccttccacat gaacgggctc       600
     gaataccacg gacaggtctc cttcatgaag gccggcctgt acttcgccga ccgcatcacc       660
     accgtgagcc cgacctacgc gcgcgagatc cagacgcccg agcagggctg cggcctcgac       720
     ggcctgctgc gccagcgcag cggcgcgctc accggcatcc tcaacgcggt ggacgacaag       780
     gtctggaacc ccgccgccga cgctgcgctg gtgcagggct atcactcgcc cgaaggccgc       840
     cacatggcgg gcaaggcgcg ctgcaaggcg gtgctgcaac accagctcgg cctggccgag       900
     cggccggacg cgccactctt catcctggtg agccggctca ccgaacagaa gggcctgcac       960
     ctcgtgctcg gcggcatcga tgcgctgctc gcccaaggcg gccagctcgc gctgctgggc      1020
     agcggcgaag cgtggctcga agaggctttt cgccagcgcg cggcggcggc gccgcaatcg      1080
     gtcagcgtca ccatcggcta caacgaaacg ctggcgcacc agctcttcgg cggcggcgat      1140
     gtgacgctgg tgccttcgct cttcgagccc tgcggcctca cgcagatgta cggcctgaag      1200
     tacggcagcc tgccgctggt gcgccgcgtg ggcggcctcg ccgacacggt ggtcgacagc      1260
     acgctggaag acatggcgag cggcgaggcc accggcttcg tgttcgaccg cttcgacgca      1320
     gccgactacg aacgcgcgct gcgccgcgcc ttcgccctct acgagcgcgc gcccgactgg      1380
     cgccgcgtgc gcggcaacgc catgcggcgc ccggccgact gggccacggc cgccgcgcaa      1440
     tacatcgacg tctaccggca ggcgcaggcg cccacctga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page