(data stored in ACNUC1104 zone)

EMBL: CP002417.PE440

CP002417.PE440       Location/Qualifiers
FT   CDS_pept        complement(472122..474212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0441"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; KEGG: vap:Vapar_0414 glycogen debranching
FT                   enzyme GlgX; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34663"
FT                   /db_xref="GOA:E6V4B7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B7"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ADU34663.1"
FT                   /translation="MLSPGTPFPLGATPSKEGVNFALAAPTAESVELCLFDSTGQNEQQ
FT                   RLQLPACTDGIWHGLLPSGHEGLVYGYRVHGPWAPHEGQRFNPAKLLLDPYAREIVGRY
FT                   NGSDLFLGHDPANPDQRDTRDNGTVALKGRVTTASRSNATPPGHARIAATDRVLYELHV
FT                   RGQTRLHPGVPAPLRGTYAGLAEPAVLDHLQRLGVTTLSLMPVQHRADEQRLLAMGLSN
FT                   YWGYNTIGWFAPEARYWSGRPGTTPASEFRAMADAVHARGMELVIDVVYNHSAESDEVG
FT                   PTLSMRGIDNALYYHLREDDRALYENWTGTGNCLNLREPRVLQLVMDSLRFWACEMGVD
FT                   GFRFDLAPVLGRDAKTGFDARAPFFAAIAQDPVLSRTLLIAEPWDIGPGGYRLGEFPSG
FT                   WLEWNDRYRDTQRGFWLRQGRDDASGLGDFAHRFTASSTQFAHHGRAPTASVNFITAHD
FT                   GFTLRDLVSYEERHNLANGENNRDGHGHNLSNNCGVEGPSDDAGVLAKRSRLQRALLAV
FT                   LLLSQGTPMLLAGDELGHSQQGNNNAYCQDNETTWLAWIGASDPASDMARTSDFVARLS
FT                   ALRREAPVLRSTRWWPADPPEGAPAIRWLRPDGQPMTPHDWHAGTALAILFDNNESAES
FT                   KDAGAWLVLVNAGAETVNFTLLPGNWRHRLSTDPGHDHDASPQALGDAVEVSCSSIRIA
FT                   RT"
     atgctgagcc caggcactcc attccccttg ggcgcaacgc catcaaaaga aggcgtcaat        60
     ttcgcattag cagcccccac cgcagagtcc gtagaactct gtcttttcga cagcacgggg       120
     cagaacgaac agcaacgcct ccagctgcct gcatgcaccg atggcatctg gcacggcctg       180
     ctgccgagcg ggcacgaagg cctcgtctac ggctaccgcg tccacggccc ttgggcgccg       240
     catgaaggcc aacgcttcaa ccccgccaag ctgctgctcg atccgtatgc gcgagagatc       300
     gtcggccgct acaacggcag cgacctcttc ctcggccacg acccggcaaa tcccgatcaa       360
     cgcgacaccc gcgacaacgg aacagtcgcc ctcaagggac gcgtgacgac ggcgagcaga       420
     agcaacgcaa cgcctccagg ccacgcacgc atcgcggcaa cagatcgcgt cctctacgaa       480
     ctgcacgtcc gcggccagac ccgcctgcac cccggcgtgc ccgcccccct gcgcggcacc       540
     tacgccggcc tcgccgagcc cgcagtgctc gaccacctgc agcgcctggg cgtcaccacg       600
     ctcagcctca tgcccgtgca gcatcgcgcc gacgaacagc gcctgctcgc catgggcctc       660
     tccaactact ggggctacaa caccatcggc tggttcgcgc ccgaggcgcg ctactggagc       720
     ggccgccccg gcaccacgcc cgcgagcgag ttccgcgcga tggccgacgc ggtgcatgcg       780
     cgcggcatgg aactcgtgat cgacgtggtc tacaaccaca gcgccgagag cgacgaggtc       840
     ggcccgacgc tctcgatgcg cggcatcgac aacgccttgt actaccacct gcgcgaggac       900
     gaccgcgcgc tctacgaaaa ctggacgggc accggcaact gcctgaacct ccgcgagccc       960
     cgcgtgctgc aactcgtgat ggacagcctg cgcttctggg cgtgcgagat gggcgtcgac      1020
     ggcttccgct tcgacctcgc accggtgctg ggacgcgatg cgaagacggg gttcgatgcg      1080
     cgcgcgccct tcttcgcggc catcgcgcaa gacccggtgc tctcgcgcac gctgctgatc      1140
     gcggagccgt gggacatcgg ccccggcggc taccggctcg gcgagttccc atcaggctgg      1200
     ctcgaatgga acgaccgcta ccgcgacaca cagcgcggct tctggctgcg gcaagggcgc      1260
     gacgacgcaa gcggcctcgg cgatttcgcg caccgcttca ccgcctcgag cacccagttc      1320
     gcccaccacg gccgcgcgcc gacggcgagc gtcaacttca tcaccgcgca cgacggcttc      1380
     acgctgcgcg acctcgtgag ctacgaagag cgccacaacc tcgcgaacgg cgagaacaac      1440
     cgcgacggcc acggccacaa cctgagcaac aactgcgggg tcgaaggccc gagcgacgat      1500
     gcgggcgtgc tggcgaagcg cagccgcctg cagcgcgcgc tgctcgcggt gctgctgctc      1560
     tcccaaggca cgccgatgct gctggccggc gacgagctgg gccacagcca gcagggcaac      1620
     aacaacgcct actgccagga caacgagacc acctggctcg catggatcgg cgcctccgac      1680
     cccgccagcg acatggcgcg cacgagcgat ttcgtcgcgc gcctttcggc cctgcgccgc      1740
     gaagcgccgg tgctgcgcag cacgcgctgg tggccggccg atccgcccga aggcgcaccg      1800
     gccatccgct ggctgcgccc cgacggccag ccgatgacgc cacacgactg gcatgcgggc      1860
     acggcgcttg cgatcctctt cgacaacaac gaaagcgcgg agagcaagga cgcgggcgca      1920
     tggctggtgc tggtcaatgc gggggcggag acagtgaatt tcacgctgct cccgggcaac      1980
     tggcgccacc gtctctcgac cgatccgggg catgaccacg acgcctcgcc ccaggcactc      2040
     ggcgatgcgg tggaggtgtc ttgctcgagc atccggattg caagaacgta g               2091
//

If you have problems or comments...

PBIL Back to PBIL home page