(data stored in SCRATCH zone)

EMBL: CP002417.PE441

CP002417.PE441       Location/Qualifiers
FT   CDS_pept        complement(474206..475027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0442"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34664"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4B8"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0518"
FT                   /protein_id="ADU34664.1"
FT                   /translation="MGLESSFFPRPGLAPAGDLLSFASPKERKQRKGDPAVCVPPLRCG
FT                   QPAVLAFRGVRRTRFAQTAAALIRETLRSSAHTEGLWGPHTPSLRSAAPSGLRFARLGL
FT                   APSPSGGRLGWGHATLDETRLCSKGRRAPIPAFPRKGKEQCTKPGVPCLVFLPPLPGEG
FT                   RGGGTAAERSNGPTASRAKQWPGLSPPPSGCAEERSGSRTRARRCLSEASSARPREPRA
FT                   PQVARSEAEGRRQWGRLSFAYLSLAKQRKVGRLPGRDPASEKKQTQGQQEC"
     atgggtcttg aatcgtcttt tttcccgagg ccgggtctcg ccccggcggg cgacttactt        60
     tcttttgctt cgccaaaaga acgtaagcaa agaaaaggcg accctgctgt ctgcgtccct       120
     ccgcttcgct gcgggcaacc tgcggtgctc gcgtttcgcg gggtccgcag aactcgcttc       180
     gctcaaacag ctgcggccct gatccgcgaa acgctgcgct cctcggcgca tacagaaggg       240
     ctttggggac cccacacgcc atcgctgcgc tcggcggcgc cctcgggcct tcgcttcgct       300
     cggcttggtt tggctccctc cccttccggg ggaaggctgg ggtgggggca cgcgacgctc       360
     gatgagacgc ggctgtgcag caagggccgt cgtgccccca tcccagcctt cccccggaag       420
     gggaaggagc aatgcaccaa gcccggtgtc ccatgtcttg tctttctccc tcccctcccg       480
     ggggagggcc ggggtggggg caccgcggcc gagcgaagca atggcccgac tgcaagccga       540
     gcgaagcaat ggcccgggtt gtctccaccc ccctctggct gcgccgagga gcgcagcggt       600
     tcgcggacaa gggctcgccg ctgtctgagc gaagcgagtt cggcgagacc ccgcgaaccg       660
     cgagcaccgc aggttgcccg cagcgaagcg gagggtcgca gacagtgggg tcgcctttct       720
     tttgcctacc tttctttggc gaagcaaaga aaagtaggtc gcctgccggg gcgagacccg       780
     gcctcggaaa aaaaacaaac ccaagggcaa caagaatgct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page