(data stored in SCRATCH zone)

EMBL: CP002417.PE448

CP002417.PE448       Location/Qualifiers
FT   CDS_pept        484948..486243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0449"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; KEGG:
FT                   vap:Vapar_0425 gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34671"
FT                   /db_xref="GOA:E6V4C5"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C5"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ADU34671.1"
FT                   /translation="MNAFNVSEHMQALGLQAKTAAFLMARADAATKNIALKALARRLRE
FT                   AGPALSVANQKDLERATAAGLSAPMVDRLKLTPKVIETVALGCEQLAGMADVIGEMIGM
FT                   KQQPSGIRVGQMRVPIGVFGMIYESRPNVTIEAASLAIKSGNAAILRGGSEAIESNKAL
FT                   ALLVSEALAEAGLPVEAVQLVQTTDREAVGQLIAMPEFVDVIIPRGGKGLIERISRDAK
FT                   VPVIKHLDGNCHVYVDDTAEFGMALRIVDNAKTQKYSPCNAAEGLLVSEVVAEDFLPQI
FT                   AAIFAAKGVEMRCDPAAARILRSDEAALDPAAKVIDAVETDWSEEYLAAVISIKVVAGV
FT                   DEAIAHINRYSSHHTDAIVTRDHVHAQRFLREVDSASVMVNASTRFADGFEFGLGAEIG
FT                   ISTDKFHARGPVGIEGLTSLKYVVLGQGEVRT"
     atgaatgcgt tcaacgtcag cgagcacatg caggccctag ggctgcaggc aaagaccgct        60
     gctttcctca tggcccgtgc ggatgcagct accaaaaaca tagcattgaa ggcgctcgcg       120
     cggcgcctgc gcgaagccgg cccggcgctg tcggtcgcca atcagaaaga cctggaacga       180
     gccaccgccg ccggactttc ggccccgatg gtcgatcgcc tcaagctcac gccgaaggtc       240
     atcgagaccg tggccctggg ctgcgagcaa ctcgccggca tggccgacgt gatcggcgaa       300
     atgatcggca tgaagcagca gcccagcggc atccgcgtgg gccagatgcg ggtgccgatc       360
     ggcgtgttcg gcatgatcta cgagagccgt cccaacgtga ccatcgaggc cgcgagcctc       420
     gcgatcaagt cgggcaacgc cgccatcctg cgcggcggct cggaagccat cgaatcgaac       480
     aaggcgctgg cgctgctggt gtccgaggcg ctggccgagg ccggcctgcc ggtcgaggcg       540
     gtgcagctgg tgcagaccac cgaccgcgag gccgtgggcc agctcatcgc catgcccgaa       600
     ttcgtggacg tgatcattcc gcgcggcggc aaggggctca tcgagcgcat cagccgcgac       660
     gccaaggtgc cggtcatcaa gcacctggac ggtaactgcc atgtttatgt agacgacacg       720
     gccgagttcg gcatggcgct gcgcatcgtg gacaacgcca agactcagaa gtacagcccc       780
     tgcaacgccg ccgaaggcct gctggtctcg gaggtggtcg cggaagactt tttgccccag       840
     atcgccgcga tcttcgccgc caagggcgtg gaaatgcgct gcgacccggc cgccgcccgc       900
     atcctgcgtt cggacgaggc ggcgctcgac ccggctgcca aggtcatcga tgcggtcgag       960
     accgactggt ccgaggaata cctggccgcc gtgatcagca tcaaggtcgt ggccggcgtc      1020
     gatgaggcca ttgcgcacat caaccgctat tcaagccacc acaccgacgc catcgtcacg      1080
     cgcgaccacg tgcatgctca gcgctttttg cgcgaggtcg attcggccag cgtcatggtc      1140
     aatgcgagca cccgcttcgc ggacggtttc gagttcggcc tgggcgctga aatcggcatc      1200
     agcaccgaca agttccacgc ccgcggcccg gtcggcatcg aagggctgac ctcgctcaag      1260
     tacgtggtgc tcggccaagg cgaagtgcgg acgtga                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page