(data stored in ACNUC1104 zone)

EMBL: CP002417.PE449

CP002417.PE449       Location/Qualifiers
FT   CDS_pept        486336..487652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0450"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="KEGG: vap:Vapar_0426 glutamate/cysteine ligase;
FT                   TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34672"
FT                   /db_xref="GOA:E6V4C6"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C6"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ADU34672.1"
FT                   /translation="MVPHLVTALTGPINELEQRVLDSMPAIERWFRLEWMEHTPPFYSS
FT                   VDIRNAGFKLAPVDTNLFPGGWNNLTKEMLPLAVQAAQAAIEKICPEARNLLVIPENHS
FT                   KNTFYLANIAQLVRIFHMAGLNVRIGSVDPAIKSPKKIELPNGETVTLEPVVRGKRRLG
FT                   LKNFDPCTILLNNELSAGTPGILEDLHEQYLLPPLHAGWSVRRKSNHLHSYEELSKRLG
FT                   KLLGIDPWLINPIYARAEGVDIAEGRGIDVLTSHVDAVLTKVRRKYKEYGINEKPFVVV
FT                   KGGHSGSGSPGVVTVRDAKEVEALIGKSRTSTSSAAKTSAGRDLREPTELIVQEGVLTN
FT                   ERVHNGVAEPVVYMMDRYVVGGFYRVHAEQAADENLKLPGASYVPLAFSESTHMPQPGA
FT                   KPGASAPNRFYMYGVVGRLAMVAASYEMEATDPDAEIYE"
     atggttccgc atctcgtcac cgccctgacc ggcccgatca acgaactgga acagcgggtg        60
     ctcgactcga tgcccgccat cgagcgctgg ttccgccttg agtggatgga gcacacgccg       120
     ccgttctaca gctccgtcga tatccgcaat gcaggcttca agctcgcgcc ggtcgacacc       180
     aatctctttc cgggtggctg gaacaacctc accaaagaga tgctgccgct ggcggtgcag       240
     gccgcgcagg cagccatcga gaagatctgc ccggaggcgc gcaacctgct cgtcattccg       300
     gaaaatcact ccaagaacac cttttatctc gccaacatcg cgcaacttgt gcgcatcttc       360
     catatggcgg ggctcaacgt gcgaatcggc tccgtcgatc cggcgatcaa gtcgcccaag       420
     aagatcgaat tgcccaacgg cgagaccgtg accctggagc cggtggtgcg cggcaagcgg       480
     cggctgggtt tgaagaattt cgatccctgc acaattctgc tcaacaacga gctttcggca       540
     ggaacgccgg gcatcctcga ggaccttcac gagcagtacc tcttgccgcc gctgcacgcg       600
     ggctggtcgg tgcgccgcaa gagcaaccac ctgcacagct atgaggagct gtccaagcgc       660
     ctgggcaagc tcttgggcat cgatccctgg ctcatcaacc cgatctacgc gcgcgccgaa       720
     ggcgtcgaca ttgccgaggg gcgcggcatc gacgtgctga ccagccatgt cgatgcggtg       780
     ctcaccaagg tgcgccgcaa gtacaaggaa tacggcatca acgaaaagcc cttcgtcgtc       840
     gtcaagggcg gccacagcgg cagcggcagc ccgggcgtgg tgacggtgcg cgatgccaag       900
     gaagtcgagg cgctgatcgg caagtcgcgc accagcacgt cctcggcagc caagacctcc       960
     gccggccgcg acctgcgcga acccaccgag ctgatcgtcc aggaaggcgt gctgaccaac      1020
     gagcgcgtgc acaacggcgt ggccgaaccg gtcgtctaca tgatggaccg ctacgtggtg      1080
     ggcggcttct accgggtgca cgccgagcag gcggccgacg agaacctcaa gctgccgggc      1140
     gcgagctacg tgccgctggc tttctcggaa agcacgcaca tgccccagcc tggtgccaag      1200
     cccggcgcga gcgccccgaa ccgtttctat atgtatggcg tggtcggccg cctggccatg      1260
     gtcgcggcca gctacgagat ggaagcgacc gacccggacg ccgaaatcta cgaatga         1317
//

If you have problems or comments...

PBIL Back to PBIL home page