(data stored in ACNUC1104 zone)

EMBL: CP002417.PE450

CP002417.PE450       Location/Qualifiers
FT   CDS_pept        487836..489704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0451"
FT                   /product="potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG: vap:Vapar_0427
FT                   K potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34673"
FT                   /db_xref="GOA:E6V4C7"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C7"
FT                   /inference="protein motif:PFAM:PF02705"
FT                   /protein_id="ADU34673.1"
FT                   /translation="MSAPKTISAGLIVGAIGVVYGDIGTSVLYAVKEVFGHGHVPFTVQ
FT                   NVYGILSMFFWTLTVIVSIKYVVLVLRADNEGEGGLVAMLALASRAVADKPRLRHVLLV
FT                   IGIFGTSLFYGDGVITPAISVLSAVEGLEVVSPHFKHYVIPITLVVLFCLFAVQKRGTA
FT                   GIGKFFGPVTLAWFAAIAVLGVWQILHHPEIVKALNPWYALKFIWDNPGTSFILLGAMV
FT                   LCVTGAEALYADLGHFGKKPIRIAWFSVVMPALTLNYLGQGALLLENPEAVKNPFFMMA
FT                   PEWALIPLVLLATLSTVIASQALITGAFSVTRQVIQLGYLPRLNIEHTSVRTAGQIYIP
FT                   LVNWGLFVAIVLAVVMFRTSSSLAAAYGIAVTTDMLITTILTFFVIRYAWKLPLALCIA
FT                   STAVFFVVDFLFFASNLLKMFEGGWFPLLIGGFVFTLMITWKEGRRLMGEAQHADAIDL
FT                   KSFLDSVFVSPPARVDGTAVFLTAEPGVVPNALLHNLKHNKVLHEQNMFVTVRNHEVPW
FT                   IPMDKRIEIEALGHHCWQVIVHYGFKNDIDLPRALEHARLRGCQLEPMATSYFLSRDVV
FT                   IPTLGSGMAPWREKLFAQMHHNASGAAAFLGLPNNAVVELGSKIEI"
     gtgtcagccc ccaaaacaat ctctgccggc ctgatcgtcg gcgccatcgg cgtcgtctac        60
     ggcgacatcg gcaccagcgt gctgtatgcg gtcaaggaag tgttcggcca cggccacgtg       120
     ccgttcaccg tccagaacgt ctacggcatc ctgtcgatgt tcttctggac gctcaccgtc       180
     atcgtctcga tcaagtacgt ggtgctggtg ctgcgcgccg acaacgaagg cgagggtggc       240
     ctcgtcgcca tgctcgcgct ggcgtcccgg gcggtcgccg acaagccgcg ccttcggcat       300
     gtgctgctgg tgatcggcat cttcggcacc tcgctcttct acggcgatgg cgtcatcacg       360
     ccggccattt cggtgctgtc ggcggtcgag ggcctggagg tggtgtcgcc gcacttcaag       420
     cactacgtga tcccgatcac cctggtcgtg ctgttctgcc tcttcgccgt gcagaagcgc       480
     ggcaccgcag gcatcggcaa gttcttcggc ccggtcacgc tggcgtggtt cgcggccatc       540
     gcggtgctgg gcgtgtggca gatcctgcac caccccgaaa tcgtcaaggc gctcaacccc       600
     tggtatgcgc tgaagttcat ctgggacaac ccgggcacca gcttcatcct gctgggcgcg       660
     atggtgctgt gcgtgactgg cgccgaggcg ctgtacgccg acctgggcca cttcggcaag       720
     aagccgatcc gcatcgcgtg gttctcggtc gtcatgccgg cgctcacgct caactacctc       780
     ggccagggcg cgttgctctt ggagaacccc gaggcggtga agaacccctt cttcatgatg       840
     gcgcccgagt gggcgctgat tccgctggtg ctgctggcca cgctgtcgac ggtgatcgcg       900
     tcgcaggcgc tcatcaccgg cgcgttcagc gtcacgcgac aggtgatcca gctgggctac       960
     ctgccgcgac tgaacatcga acacaccagc gtgcgcacgg ccgggcagat ctacattccg      1020
     ctcgtcaact ggggcctgtt cgtggccatc gtgctggcgg tggtgatgtt ccgcacctcg      1080
     agcagcctgg ccgcggccta tggcatcgcg gtgacgaccg acatgctgat caccacgatc      1140
     ctgaccttct tcgtgatccg ctacgcgtgg aagctgccgc tggcgctgtg catcgcatcg      1200
     accgcggtct tcttcgtggt cgacttcctg ttcttcgcct cgaacctgct caagatgttc      1260
     gaaggcggct ggttcccgct gttgatcggc ggcttcgtgt tcacgctgat gatcacctgg      1320
     aaggaaggcc gccggttgat gggcgaggcg cagcacgccg acgcgatcga tctcaaatct      1380
     tttctcgact ccgtgttcgt gagcccgccg gcgcgcgtgg acggcacggc cgtgttcctc      1440
     accgccgagc cgggcgtcgt gcccaatgcg ctcctgcaca acctgaagca caacaaggtg      1500
     ctgcacgagc agaacatgtt cgtcaccgtg cgcaaccacg aggtgccctg gattccgatg      1560
     gacaagcgca tcgagatcga agcgttgggc caccactgct ggcaggtcat cgtgcattac      1620
     ggcttcaaga acgacatcga cctgccgcgc gcgctcgagc atgcgcgcct gcgcggctgc      1680
     cagctggagc cgatggccac gagctacttc ctctcgcgcg acgtcgtgat tccgacgctg      1740
     ggcagcggca tggcgccgtg gcgcgagaag ctgttcgcgc agatgcacca caacgcgagc      1800
     ggagcggcgg ccttcctcgg gttgccgaac aacgcggtgg tggagctggg gtcgaagatc      1860
     gagatctga                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page