(data stored in ACNUC1104 zone)

EMBL: CP002417.PE451

CP002417.PE451       Location/Qualifiers
FT   CDS_pept        complement(489730..490653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0452"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   vap:Vapar_0429 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34674"
FT                   /db_xref="GOA:E6V4C8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4C8"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADU34674.1"
FT                   /translation="MTTRWPDLLPSHDRFDYRPITRRPDYVWPNGARLAVYLGFNIEHF
FT                   AFGDGLGACIGPASPQPDVLNHGWREYGNRVGAWRCLELFDALALPTGALINTALYDHC
FT                   PELVAACVARGDELIGHGHSNAERQGALDEEHERALLLRCRERMLRESGQAPAGWLSPW
FT                   ISESAVTPDLLGETGYGYTLNWCHDDQPVRMRTRGGGSIWSVPYPQELNDIPMIVGRLM
FT                   DAKDFSAMVVDNFDEMLEQSRAQPLVMGLALHPYIVGQPYRLRHLRTALAHLARARDRG
FT                   EIWFTTPGAIAGHMTQLAAERPEEFG"
     atgacgacac gctggcccga cctcctgccc tcgcacgatc gtttcgacta ccggccgatc        60
     acgcggcgcc ccgactacgt ttggccgaac ggcgcgcggc tggccgtgta cctcggcttc       120
     aacatcgagc acttcgcctt cggcgacggc ctgggcgcgt gcatcggccc ggcctcgccg       180
     cagcccgatg tgctgaacca cggctggcgc gaatacggca accgcgtggg cgcatggcgc       240
     tgcctcgaac tcttcgacgc gctcgcgctg ccgaccggtg cgctcatcaa cacggcgctc       300
     tacgaccact gcccggaact ggttgcggcc tgcgtggcgc gcggcgacga actcatcggc       360
     cacggccaca gcaacgcgga gcgccagggc gcgctggacg aagaacacga acgcgcgctg       420
     ctgctgcgct gccgcgaacg catgctgcgc gaaagcggac aggcgcccgc gggctggctg       480
     tcgccgtgga tctccgagag cgctgtcacg cccgacctgc tcggcgaaac cggctacggc       540
     tacacgctca actggtgcca cgacgaccag ccagtgcgca tgcgtacgcg cggcggcggc       600
     tcgatctggt cggtgcctta tccgcaggag ctcaacgata ttccgatgat cgtgggacgc       660
     ctgatggatg cgaaggattt cagcgcgatg gtggtcgaca acttcgacga gatgctggaa       720
     cagtcgcgcg cgcagccgct ggtgatgggg ctcgcgctgc atccgtacat cgtcggccag       780
     ccataccggc tgcgccacct gcgcacggcg ctcgcgcatc tggcacgtgc gcgggatcgt       840
     ggggagatct ggttcacgac gccgggggcg atcgcggggc acatgacgca gcttgcggcg       900
     gaacggcccg aagagttcgg ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page