(data stored in SCRATCH zone)

EMBL: CP002417.PE453

CP002417.PE453       Location/Qualifiers
FT   CDS_pept        491372..492325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0454"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="TIGRFAM: glutathione synthetase; KEGG:
FT                   vap:Vapar_0432 glutathione synthetase; PFAM: glutathione
FT                   synthetase ATP-binding; glutathione synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34676"
FT                   /db_xref="GOA:E6V4D0"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D0"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ADU34676.1"
FT                   /translation="MKNILFVADPLDHFKIYKDTTFSMMREAQRRGHRIAACLPQDIQW
FT                   KSGGLVTATVQQITLTGDAKDWYTVDITESKALKDFDAVLMRKDPPFDAEYIYSTHLLQ
FT                   QAEREGAQVVNSPRALRDHPEKLAIMEFPQFVTPTLVTRSAQAVRDFHAEHGDIILKPL
FT                   DGMGGMGIFRVKQDALNLGSIVETLNKDGAETIMVQRFVPEVSQGDKRILIIAGEPAPF
FT                   VLARIPQGTEVRGNLAAGGKGVAQPLTPRNREIAEAIGKVLAPRGLLLIGLDVIGDSVT
FT                   EINVTSPTCFQEITEQTGFDVPKMFIDALEKTLRPA"
     atgaaaaaca tcctcttcgt cgccgacccg ctcgatcact tcaaaatcta caaggacacc        60
     accttctcga tgatgcgcga ggcccagcgc cgcggtcacc gcatcgcggc gtgcctgccg       120
     caggacatcc agtggaaatc gggcgggctg gtcacggcga cggtgcagca gatcacgctg       180
     accggtgacg ccaaggactg gtacaccgtc gacatcaccg aatcgaaggc gctgaaagac       240
     ttcgacgcgg tgctgatgcg caaggacccg cccttcgacg ccgagtacat ctattcaacg       300
     cacctcctgc agcaggccga gcgcgagggc gcgcaggtgg tcaattcgcc gcgcgcattg       360
     cgcgaccacc ccgagaagct cgcgatcatg gagtttccgc agttcgtgac gcccacgctg       420
     gtcacccgca gcgcgcaggc cgtgcgcgac ttccatgcgg agcacggcga catcatcctg       480
     aagccgctcg acggcatggg cggcatgggc atcttccgcg tgaagcagga cgcgctgaac       540
     ctcggctcca tcgtcgagac gctcaacaag gacggcgccg aaacgatcat ggtgcagcgc       600
     ttcgtacccg aggtttctca gggcgacaag cgcatcctga tcatcgcggg cgagccggcg       660
     cccttcgtgc tggcgcgcat tccgcagggc accgaggtgc gcggcaatct cgcggccggc       720
     ggcaagggcg tggcgcagcc gctgacgccg cgcaaccgcg agatcgccga ggccatcggc       780
     aaggtgctcg cgccgcgcgg gctgctgctg atcgggctcg acgtgatcgg cgactcggtc       840
     accgagatca acgtgaccag cccgacctgc tttcaggaaa tcacggagca gaccggcttc       900
     gacgtgccga agatgttcat cgacgcgctg gagaaaaccc tgcgtcctgc ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page