(data stored in ACNUC1104 zone)

EMBL: CP002417.PE454

CP002417.PE454       Location/Qualifiers
FT   CDS_pept        complement(492288..493592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0455"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="KEGG: vap:Vapar_0433 PepSY-associated TM helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34677"
FT                   /db_xref="GOA:E6V4D1"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D1"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0433"
FT                   /protein_id="ADU34677.1"
FT                   /translation="MRAFATGIHRWAGLAVALFLVVSGLTGAVISWDHEIDGWLNRKLY
FT                   DTQSRGPFKDPFELAAAVEAHDPRARVAYMPLGFEEGHAAGYFVQPRVDPATGKPFRLG
FT                   YNQVFVDPVTAEVRGRRDSTAISLKPETLMPFLRKLHYMLHVPAMWGTDRIGWWIMGTV
FT                   ALVWLLDSFVALYLTMPRRLRKAVHPTHRPAAAWWQRWKPSWTVRWAAGGYKLNFDLHR
FT                   AGGLWIWGLIIVVAFTSFSLNLYKEVFHPMLSLVSKTTPGPSALVPLAPLGTRIEPTIG
FT                   FREIVAQAEAEARRRGWTTPLGGAFYNARGGFYNISFFDHATHDDSDGMGLSNLYLDGR
FT                   DGHVISSNRPWHGTAADVFAQLQLPLHGGRILGMPGRIMMSALGLVVAMLSITGIVIWA
FT                   RKLRSRRLQARREREQARTAAPGFRQDAGFSPARR"
     atgcgcgcct tcgcgaccgg catccaccgc tgggccggcc tggcggttgc gctgttcctc        60
     gtcgtctcgg gcctgaccgg cgccgtcatc tcgtgggacc acgagatcga cggctggctc       120
     aaccgcaagc tctacgacac gcaaagccgc ggccccttca aggacccgtt cgagctggcc       180
     gccgcggtcg aggcgcacga tccgcgcgcg cgggtcgcgt acatgccgct cggcttcgaa       240
     gagggccatg ccgccggcta cttcgtgcag ccccgcgtcg atccggccac cggaaagccc       300
     ttcaggctcg gctacaacca ggtgttcgtc gacccggtca cggccgaggt gcgcggccgg       360
     cgcgactcca cggccatctc gctcaagccc gagacgctga tgccgttcct ccgcaagctc       420
     cactacatgc tgcacgtgcc ggcgatgtgg ggcaccgacc gcatcggctg gtggatcatg       480
     ggcacggtgg cgttggtgtg gctgctcgac agcttcgtcg cgctctacct cacgatgccg       540
     cgacggctgc gcaaggccgt gcacccgacg caccggccgg cagccgcctg gtggcagcgc       600
     tggaagccgt cgtggaccgt gcgctgggcg gccggcggct acaagctcaa cttcgacctg       660
     caccgcgcgg gcgggctgtg gatctggggg ctgatcatcg tcgtcgcctt cacctcgttc       720
     tcactgaacc tctacaagga ggtgttccac ccgatgctct cgctggtttc caagaccacg       780
     cccggaccgt cggcgctggt gccgctcgcg ccgctgggca cgcgcatcga gcccaccatc       840
     ggcttccgcg agatcgtggc gcaggctgaa gcggaggccc gacgccgcgg ctggacgacg       900
     ccgctgggcg gcgcgttcta caacgcgcgc ggcggcttct acaacatctc gttcttcgac       960
     cacgccacgc acgacgacag cgacggcatg ggcctgtcga acctctacct cgacggccgc      1020
     gacggccacg tcatcagcag caatcgccca tggcacggca ccgccgccga cgtgttcgcg      1080
     cagctgcaat tgccgctgca cggcgggcgc atcctgggca tgccggggcg catcatgatg      1140
     tcggcgctgg ggctggtggt ggcgatgctg tcgatcaccg gcatcgtcat ctgggcgcgc      1200
     aagctgcgct cacggcgact gcaggcccgg cgcgagcgcg aacaggcccg caccgcggcg      1260
     cccgggttca ggcaggacgc agggttttct ccagcgcgtc gatga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page