(data stored in SCRATCH zone)

EMBL: CP002417.PE456

CP002417.PE456       Location/Qualifiers
FT   CDS_pept        complement(495915..496703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0457"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="KEGG: vap:Vapar_0435 glutamine amidotransferase
FT                   class-II; manually curated; PFAM: glutamine
FT                   amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34679"
FT                   /db_xref="GOA:E6V4D3"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D3"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADU34679.1"
FT                   /translation="MCQLLGMNCNTPTDVTFSFTGFAQRGGRTDHHADGWGIAFFEDRG
FT                   LRHFVDHQPACESPVAELIRRYPIQSRNVIAHIRKATQGEVNLQNCHPFVRELWGRYWV
FT                   FAHNGDLKDFRPRLHGNFHPVGNTDSEHAFCWLMQELAKSHAGVPSIDELTLTLRELAP
FT                   QLASHGTFNFMLSNGQALWAHASTNLWYVERRHPFVTAQLSDEDLEIDFAQHTTPTDRV
FT                   AVVVTTPLTTNETWTQFAPGELHVFVDGQRSVGRDPNEAF"
     atgtgtcaat tgctagggat gaactgcaac acgccgaccg acgtgacctt cagcttcacg        60
     gggttcgcgc agcgcggtgg ccgcaccgac caccacgcgg acggctgggg catcgcgttc       120
     ttcgaggacc ggggcctgcg ccatttcgtc gatcaccagc cggcctgcga atcgccggtg       180
     gcggagctga tccggcgcta cccgatccag agccgcaacg tcatcgcgca catccgcaag       240
     gcgacgcagg gcgaggtcaa ccttcagaac tgccatccgt tcgtgcggga gctgtggggg       300
     cgctactggg tgttcgccca caacggcgac ctgaaggact ttcggccgcg actgcatggc       360
     aatttccatc ccgtgggcaa caccgacagc gagcacgcct tctgctggct gatgcaggaa       420
     ctcgcgaagt cgcatgcggg cgtgccgagc atcgatgaat tgacgctcac cctgcgcgaa       480
     ctggctccgc aactcgcgag ccacggcacc ttcaacttca tgctgtcgaa cgggcaggcg       540
     ctgtgggcgc atgcatcgac caacctctgg tacgtggagc gccggcatcc gttcgtgacg       600
     gcgcagctgt ccgacgaaga cctggaaatc gacttcgccc agcacaccac gcccaccgat       660
     cgcgtggccg tggtcgtgac gaccccactc accacgaacg aaacgtggac ccagttcgcg       720
     ccaggcgaac tgcatgtgtt cgtggacggg caacggtcgg tcggccgaga tccaaacgaa       780
     gccttttga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page