(data stored in SCRATCH zone)

EMBL: CP002417.PE46

CP002417.PE46        Location/Qualifiers
FT   CDS_pept        complement(49273..50055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0046"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   vap:Vapar_0041 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34269"
FT                   /db_xref="GOA:E6UXS5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS5"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU34269.1"
FT                   /translation="MAETSSTIELREEMRGPVMWLTIDREERRNAINAAVLARLSDALA
FT                   RANADAAVRAVVITGTGTRAFCAGADLQSGTSFKFDYAEPYQGFANLFRQARQSTVPLI
FT                   ARVNGACMAGGMGIMAMCDMAVASSSAVFGLPEVKVGLFPAQVLSVLDGLLPRRVLAEM
FT                   CITGEPITAAQALEHGLINRTSDDVDESIDWLLGRMLDKSPAAIRRGLYTMKKIEAMAF
FT                   EESMAFTESQIGLFALTEDAAEGQLAFREKRKPQWSGR"
     atggccgaaa cctcttccac catcgaactg cgcgaagaga tgcgcgggcc cgtgatgtgg        60
     ctcaccatcg accgcgagga gcggcgcaat gcgatcaatg ccgccgtgct cgcgcgcctg       120
     tccgatgccc tcgcgcgcgc caacgccgac gctgccgtgc gcgcggtcgt catcaccggc       180
     accggcacgc gcgccttctg cgcgggcgcc gacctgcaaa gcggcacctc tttcaagttc       240
     gactacgccg agccctacca gggcttcgcc aacctctttc gccaggcgcg gcaatcgacg       300
     gtgccgctca tcgcgcgcgt caacggcgca tgcatggccg gcggcatggg gatcatggcg       360
     atgtgcgaca tggcggtggc cagcagcagc gccgtgttcg gcctgcctga ggtgaaggtc       420
     ggcctctttc ccgcgcaagt gctcagcgtg ctcgacggcc tgctgccgcg ccgcgtgctg       480
     gccgaaatgt gcatcaccgg cgagcccatc accgctgcgc aagcgctgga acatggactg       540
     atcaaccgca cgagcgacga cgtggacgag agcatcgatt ggctgctcgg ccgcatgctc       600
     gacaaatcgc ccgccgccat ccgccgtggc ctctacacga tgaagaagat cgaggcgatg       660
     gctttcgagg aatcgatggc gttcaccgaa agccagatcg gtctcttcgc gctcaccgag       720
     gatgcagccg agggacagct cgccttccgc gaaaagcgca agccgcagtg gagcggccga       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page