(data stored in ACNUC1104 zone)

EMBL: CP002417.PE461

CP002417.PE461       Location/Qualifiers
FT   CDS_pept        complement(501141..502421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0462"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: vap:Vapar_0440
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34684"
FT                   /db_xref="GOA:E6V4D8"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D8"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ADU34684.1"
FT                   /translation="MGLRENARMPILNAFYAQSGGVTSVINASACGVIETARKHPDRIG
FT                   KLYAGRNGIIGALTEELIDTGAESAEAIAALRTTPSGAFGSCRYKLKSLEKNRREYERL
FT                   IEVFKAHGIGYFFYNGGGDSADTCFKVSQLSQSLGYPLQAIHVPKTIDNDLPLTDCCPG
FT                   FGSVAKYVAVSTIEASFDVRSMAATSTKVFVLEVMGRHAGWIAAAGGLAADQGIPVVVL
FT                   FPEIEFDKPRFLARVDELVKQHGYCSVVVSEGCHYPDGTFLAEQGTRDAFGHAQLGGAA
FT                   PVVAQMIKDAYGHKFHWAVADYLQRAARHIASATDVKQAYELGQRAVELALEGRNAVMP
FT                   TIERTSDVPYAYTLGSAPLESVANVEKPMPRDFISDDGYGITEKCRRYLLPLIEGEDYP
FT                   AYRNGLPVYVTLQNVAVAKKLPAFELA"
     atggggctgc gggagaatgc ccgcatgccc atcctcaacg ccttctacgc ccagtcgggc        60
     ggcgtcacct cggtcatcaa tgcgtcggcc tgcggcgtga tcgagacggc acgaaaacac       120
     ccggaccgca tcggcaagct ctacgccggc cgcaacggca tcatcggcgc gctgacggaa       180
     gaactgatcg acacgggcgc cgaatcggcc gaagcgattg cggccttgcg aaccacgcca       240
     tcgggcgcat tcggttcgtg ccgctacaag ctcaagtcgc tcgagaagaa ccgccgcgaa       300
     tacgagcggc tgatcgaagt cttcaaggcg cacggcatcg gctatttctt ctacaacggg       360
     ggcggcgatt cggccgacac ttgcttcaag gtgagccagc tctcgcagtc gctcggttat       420
     ccgctgcagg cgatccatgt gcccaagacc atcgacaacg acctgccgct gaccgactgc       480
     tgcccgggct tcggctcggt cgcgaagtac gtggcggtgt cgacgatcga ggcctcgttc       540
     gacgtgcgct cgatggccgc cacctcgacc aaggtgttcg tgctcgaagt gatggggcgg       600
     catgcggggt ggatcgccgc agccggcggg cttgccgcgg accagggcat tccggtggtg       660
     gtgctgtttc ctgaaatcga gttcgacaag ccgcgctttc tcgcgcgtgt cgatgaattg       720
     gtgaagcagc acggctactg ctcggtcgtg gtgtccgagg gctgccacta ccccgacggg       780
     accttcctcg cggagcaagg cacgcgcgat gcgttcggcc atgcgcagct cggcggcgcg       840
     gcgccagtgg tggcgcagat gatcaaggac gcatacggcc acaagtttca ctgggccgtg       900
     gccgactacc tgcagcgcgc ggcgcggcac attgcctcgg ccaccgacgt gaagcaggcc       960
     tacgagctgg gacagcgcgc cgtcgagctc gcgctggaag gccgcaatgc agtgatgccg      1020
     acgatcgagc gcacgtccga tgtgccctat gcgtacacgc tcggcagcgc gccgctcgaa      1080
     tcggtggcca atgtcgagaa gccgatgccg cgcgacttca tttcggacga cggctacggc      1140
     atcaccgaga aatgccggcg ctacctgctg ccgttgatcg agggcgagga ctaccccgcc      1200
     taccgcaacg gcttgccggt gtatgtgacg ctgcagaacg tcgcggtggc aaagaagctg      1260
     ccggccttcg agctcgcatg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page