(data stored in SCRATCH zone)

EMBL: CP002417.PE462

CP002417.PE462       Location/Qualifiers
FT   CDS_pept        complement(502452..503255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0463"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   vap:Vapar_0444 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34685"
FT                   /db_xref="GOA:E6V4D9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4D9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADU34685.1"
FT                   /translation="MDSQAPILYELADGIATLTLNLPAKLNPIAHGLQVELRDALERIR
FT                   DDRAVRAVILTGAGKAFCVGADLSAMTPGEEGKSLGTQTAEWMQSLSNPLIETLRTLPV
FT                   PVVAAVNGAAAGAGVGLALAADVTIAARSAYFYLPFLPKLGIVPDLGCTWAIPRRAGKA
FT                   RAMGMALLDERLSAGRAVQWGLIWACADDEQLMDEARAIAQRLARLPAHAVIEAREAFE
FT                   ASERHTLKEQLHYESERQRELIDRPTFREGVSAFLQKRPPAFESR"
     atggactccc aagcaccgat cctctacgaa ctggccgacg gcattgcgac gctcacgctg        60
     aacctgccgg ccaagctgaa tcccatcgcg catggattgc aggtcgaact gcgcgacgcg       120
     ctggagcgca tccgcgacga ccgcgcggtg cgcgccgtga tcctgacggg cgcgggcaag       180
     gcgttctgcg tcggcgccga cctgagcgcg atgacgccgg gcgaagaagg caagtcgctc       240
     ggcacgcaga ccgccgagtg gatgcagtcg ctgagcaatc cgctgatcga gacgctgcgc       300
     acgctgcctg ttcctgtggt cgccgcggtg aacggcgccg cggccggtgc gggcgtcggc       360
     ctcgcgcttg cggcggacgt gacgatcgcg gcacgcagcg cgtacttcta tcttcccttt       420
     cttccgaagc ttggcatcgt gccggacctg ggctgtacct gggcgattcc ccggcgggcc       480
     ggcaaggcgc gcgcgatggg catggcactg ctcgacgaac gcctgagcgc cggacgcgcg       540
     gtgcagtggg gcctgatctg ggcctgcgcc gacgacgaac aactgatgga cgaagcacgc       600
     gccatcgcgc agcgtcttgc acgcctgccg gcacacgcgg tgatcgaggc gcgcgaagcc       660
     ttcgaggcct ccgagcgcca cacgctgaag gaacagctgc actacgaaag cgaacgccag       720
     cgcgagctga tcgatcgccc gaccttccgc gaaggcgtga gcgcgttcct gcagaagcgt       780
     ccgcccgcgt tcgagagccg ctga                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page