(data stored in ACNUC1104 zone)

EMBL: CP002417.PE465

CP002417.PE465       Location/Qualifiers
FT   CDS_pept        complement(504664..505230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0466"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="KEGG: aav:Aave_3256 beta-Ig-H3/fasciclin; PFAM:
FT                   beta-Ig-H3/fasciclin; SMART: beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34688"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E2"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ADU34688.1"
FT                   /translation="MKKLVIALGVSVLLGACAGGMGMSGSGASNPMVGGAAMYPTKDIV
FT                   DNAVNSKDHTTLVAAVKAADLVGTLKSPGPFTVFAPTNAAFAALPAGTVDTLLKPENKP
FT                   TLTKVLTYHVVPGKMDGPALMSAINAGGGKAVLKTASGGTLTATMSGGNVMVTDAKGGT
FT                   ATVTIANVYQSNGVIHVVNKVLLPG"
     atgaaaaaac tcgtgatcgc actcggcgtt tcggtcctgc tcggcgcttg cgcgggcggc        60
     atgggcatga gcggcagcgg cgcttcgaac ccgatggtgg gcggcgccgc gatgtacccg       120
     acgaaggaca tcgtcgacaa cgccgtgaat tcgaaggacc acaccacgct ggtcgccgcc       180
     gtcaaggccg cggacctggt cggcacgctc aagagcccgg gcccgttcac cgtgtttgcg       240
     ccgaccaacg ccgcctttgc agcgctgccg gccggcacgg tcgacacgct gctcaagccc       300
     gagaacaagc ccacgctgac aaaggtgctg acctaccacg tggtgcccgg caagatggac       360
     ggccccgcgc tcatgagcgc gatcaacgca ggcggcggca aggccgtgct gaagaccgcg       420
     agcggcggca cgctcaccgc gacgatgagc ggcggcaacg tgatggtgac cgatgccaag       480
     ggcggcaccg cgaccgtgac gatcgccaat gtgtaccagt cgaacggcgt gatccacgtc       540
     gtgaacaagg tactgctgcc gggttga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page