(data stored in ACNUC1104 zone)

EMBL: CP002417.PE466

CP002417.PE466       Location/Qualifiers
FT   CDS_pept        505653..505871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vap:Vapar_0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34689"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E3"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0448"
FT                   /protein_id="ADU34689.1"
FT                   /translation="MSAQRKARDDEKRLGRFYFSVPSTAPRNPVVAAMARGESSQGAGR
FT                   HLRTHRAERRAQKVALQKAARSLGRED"
     atgagtgctc aacgaaaggc ccgcgacgac gagaagcgtc tgggccggtt ctacttttcg        60
     gtgccgtcca cggcacctcg caaccccgtg gtggccgcga tggcgcgcgg cgaatcgagc       120
     cagggcgcag ggcggcatct gcgcacgcat cgtgcggagc ggcgtgcgca gaaggtggcg       180
     ttgcagaagg ctgcacgcag cctcgggcgg gaggactga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page