(data stored in SCRATCH zone)

EMBL: CP002417.PE468

CP002417.PE468       Location/Qualifiers
FT   CDS_pept        506669..507949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0469"
FT                   /product="protein of unknown function DUF1016"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   vap:Vapar_0451 protein of unknown function DUF1016"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34691"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E5"
FT                   /inference="protein motif:PFAM:PF06250"
FT                   /protein_id="ADU34691.1"
FT                   /translation="MWANVARALPRIIQDELPQSVALPTSDKTPPRAAKTTRAKAASSS
FT                   NALLARVREILEAARAGVARTVNTTQVAANWLIGREIVEEEQRGQRRAGYGAKLLAELS
FT                   ARLNAEFGRGYSVDNLEAFRQFYLDYPQLISETASRKSTVIRELPAQPISATPSRKSIS
FT                   ESDWLPGVLHPSLSWSHYRQLLRVARMEARAFYEIEAIRNAWSVRELQRQAASLLYDRL
FT                   AKSKDKKGLMRLATHGQEVAQPLDALKDPMVIEFLGLPESPRLVESALEQALIDNLQTF
FT                   LLELGKGFAFVSRQERITIDGDHFYIDLVFYHAVLKCYVLIDLKVGKLTHADLGQIQFY
FT                   VNYYDRERRTEGDNPTLGVILCPDKNDAVVKYTLGEQQERNIFASRYQLHLPTEQELES
FT                   ELRREIRYLSVSEAVRVPAKKQAKRGA"
     atgtgggcca acgttgcgcg cgcactgccc cgcataattc aagacgaact tcctcagagc        60
     gttgccttgc caacttccga caaaactcca ccccgcgcgg cgaagacgac tcgtgccaag       120
     gcagcatctt cctcgaacgc tcttctggca cgggtgcgcg aaattctgga ggctgcgcgt       180
     gccggtgtgg cgcggacagt caacacgacg caggttgccg ccaactggtt gatcggacgc       240
     gaaatcgtcg aggaagaaca gcgcgggcag cgacgtgccg gctacggtgc aaagctgctt       300
     gccgagttgt ccgcgcgctt gaacgcggag ttcggccgtg gctactcggt ggacaacctc       360
     gaggcattcc ggcagttcta tcttgactac ccgcagctga tttccgagac ggcgtctcgg       420
     aaatcaaccg tgattcggga actgcccgcg caaccgattt ccgcgacacc gtctcggaaa       480
     tcgatttccg agtcggactg gttgccgggg gtgctgcacc cctcgctttc ctggagtcat       540
     taccggcaac tcctgcgtgt cgctcgcatg gaagcacgcg ccttttatga gatcgaggcg       600
     atccgcaatg catggtcggt gcgcgagttg cagcgtcagg cggcgagcct gttgtacgac       660
     cgcttggcga agagcaagga caagaagggc ctgatgcgat tggcaacgca tgggcaggag       720
     gtagcgcagc cgctggatgc actgaaagac ccgatggtga tcgaattcct cgggttgcct       780
     gaatctccaa ggctcgtgga gtcggcgctg gagcaggcgc tgatcgataa cctgcagacc       840
     tttctgctcg aactgggcaa aggctttgcg ttcgtgtcgc gtcaggagcg catcacgatc       900
     gatggcgatc acttctacat cgacctggtt ttctatcacg cggtgctgaa gtgctatgtg       960
     ctgatcgacc tcaaggtcgg caagctcact catgctgacc tggggcaaat acagttctat      1020
     gtgaactact acgaccgcga acgccgcacc gaaggcgaca accctacatt gggcgtcatc      1080
     ctgtgccccg acaagaacga tgcggtggtg aagtacacct tgggcgagca gcaggaacgc      1140
     aacatctttg ccagccgcta tcaattgcac ttgccgaccg aacaggaact cgaaagcgaa      1200
     ttgcgccgcg agattcgtta tctttcggtg tcggaggcgg tccgcgtacc cgcaaaaaag      1260
     caggcgaaac gaggcgcatg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page