(data stored in ACNUC1104 zone)

EMBL: CP002417.PE47

CP002417.PE47        Location/Qualifiers
FT   CDS_pept        complement(50203..50811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0047"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   vap:Vapar_0042 glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34270"
FT                   /db_xref="GOA:E6UXS6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS6"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ADU34270.1"
FT                   /translation="MKLYYSPGACSLSPHIALHEAGLAFEPVMASTKSHKLQDGTDYYG
FT                   INPLGYVPMLELDDGTRLREGPAIVQYIADLAPTKNLAPANGTLQRYRLQEWLTFIGTE
FT                   MHKGYSPLFNPNMPEEAKTIFKDKLKSRYEWLDGQLADKQYLMGEHFSVADGYLFTVTN
FT                   WTKPTGVDISAFANVQAWHARVAARPAVQEAMKAEGLLK"
     atgaagctgt attactcgcc cggtgcctgt tccctttcgc cccacatcgc gctgcacgaa        60
     gcgggccttg ccttcgaacc ggtgatggcc agcaccaaga gccacaagct gcaggacggc       120
     accgactact acggcatcaa cccgctgggc tacgtgccga tgctcgaact ggacgacggc       180
     acgcgcctgc gcgaaggccc ggccatcgtg caatatatcg ccgacctcgc ccccaccaag       240
     aacctcgcgc cggccaacgg cacgctgcag cgctatcgcc tgcaggagtg gctcaccttc       300
     atcggcaccg agatgcacaa gggctacagc ccgctgttca acccgaacat gcccgaggaa       360
     gccaagacca tcttcaagga caagctcaag tcgcgctacg aatggctcga cggccagctc       420
     gccgacaagc agtacctgat gggcgagcac ttcagcgtgg ccgacggcta cctgttcacc       480
     gtgaccaact ggaccaagcc gaccggcgtc gacatctcgg ccttcgccaa cgtgcaggcc       540
     tggcatgcgc gcgtggcggc gcgtcccgca gtgcaggaag cgatgaaggc cgaaggcctg       600
     ctaaagtaa                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page