(data stored in SCRATCH zone)

EMBL: CP002417.PE470

CP002417.PE470       Location/Qualifiers
FT   CDS_pept        complement(509385..511559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0471"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="TIGRFAM: malate synthase G; KEGG: vap:Vapar_0452
FT                   malate synthase G; PFAM: Malate synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34693"
FT                   /db_xref="GOA:E6V4E7"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E7"
FT                   /inference="protein motif:TFAM:TIGR01345"
FT                   /protein_id="ADU34693.1"
FT                   /translation="MTARTTAHGLQVATELHRFIEEKVLPATGVASDVFWKGFDAIVSD
FT                   LAPKNIALLAERDRLQSELDAWHKKNPGPIADMPAYRAFLEKIGYLLPQPKGAKATTAN
FT                   VDSELALQAGPQLVVPILNARYALNAANARWGSLYDALYGTDAIPETGGAEKGKGYNPV
FT                   RGAKVIEFARNVLDQAAPLANGSHKMATGYSVKDGKLVVALQSSSTGLADPAQFIGYQG
FT                   DAAAPSSVLLKHNGIHLDIRIDRSTAIGKTDAAGVSDLVLEAALSTILDLEDSVAVVDA
FT                   ADKVVAYANWLGIVEGTLTEEVAKGGKTFTRGLNADREYTGADGQPVKLHGRSLMFLRN
FT                   VGHLMTNPAILYAGGKEIPEGILDAVVTTTIATIDLKRKGNSRTGSIYIVKPKMHGPAE
FT                   VAFASELFGRVEQLLGLPANTVKLGIMDEERRTSVNLKACIAEAAARVAFINTGFLDRT
FT                   GDEMHTAMQGGPMIRKGDMKSSAWIGAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMA
FT                   AMLEQKIGHPKAGANTAWVPSPTAATLHALHYHQVSVTAVQQELEKIDADAERDNILNA
FT                   LLQVPIAPEAKWTAEERQQEIDNNVQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRAT
FT                   LRISSQHIANWLLHGVVTKAQVDETFQRMAKVVDEQNAGDALYQPMAGNFATSAAYKAA
FT                   QDLVFKGIEQPSGYTEPLLHAWRLKVKGEA"
     atgaccgccc gcaccaccgc ccacggactt caggtcgcga ccgagctcca ccgtttcatc        60
     gaagaaaaag tcctgcccgc caccggcgtg gccagcgatg tcttctggaa gggcttcgac       120
     gccatcgtga gcgacctcgc gcccaagaac atcgcgctgc tcgccgaacg cgaccgcctg       180
     cagagcgaac tcgacgcctg gcacaagaag aaccccggcc cgatcgccga catgccggcc       240
     taccgcgcct tcctcgagaa gatcggctac ctgctgccgc agcccaaggg cgcgaaggcg       300
     acgaccgcga acgtcgactc cgaactcgcg ctgcaggccg gcccgcagct ggtggtgccg       360
     atcctgaatg cacgctatgc gctcaacgcc gccaacgcgc gctggggctc gctgtacgac       420
     gcgctctacg gcaccgatgc catccccgaa accggcggcg ccgaaaaggg caagggctac       480
     aacccggtgc gcggcgccaa ggtcatcgag ttcgcacgca acgtgctcga tcaggccgcg       540
     ccgctggcca atggctcgca caagatggcg accggctaca gcgtgaagga cggcaagctg       600
     gtcgtcgcgc tgcagagcag cagcaccggg ctcgccgacc ccgctcaatt catcggctac       660
     cagggcgatg ccgcagcgcc gtcgtcggtg ctgctcaagc acaacggcat tcacctcgat       720
     atccgcatcg accgcagcac cgccatcggc aagaccgatg cggccggcgt gagcgacctg       780
     gtgctcgaag ccgcgctctc gaccatcctc gacctcgaag actcggtggc cgtggtggat       840
     gcggccgaca aggtcgtcgc gtatgcgaac tggctcggca tcgtcgaagg cacgctgacg       900
     gaagaagtcg ccaagggcgg caagaccttc acgcgcggcc tgaacgccga ccgcgaatac       960
     accggcgccg acggccaacc cgtgaagctg catggccgct cgctgatgtt cctgcgcaat      1020
     gtcggtcacc tgatgaccaa cccggccatc ctgtatgccg gcggcaagga gattccggaa      1080
     ggcatcctcg atgccgtggt gaccaccacc atcgccacca tcgacttgaa gcgcaagggc      1140
     aactcgcgca ccggcagcat ctacatcgtg aagcccaaga tgcacggccc ggccgaagtg      1200
     gccttcgcga gcgagctgtt cggccgcgtc gagcaactgc tcggcctgcc cgccaacacg      1260
     gtgaagctcg gcatcatgga cgaggagcgc cgcaccagcg tgaacctgaa ggcctgcatc      1320
     gccgaagcgg ccgcgcgcgt ggccttcatc aacaccggct tcctggaccg caccggcgac      1380
     gagatgcaca ccgccatgca gggcggcccg atgatccgca agggcgacat gaagtccagc      1440
     gcgtggatcg gcgcctacga aaagaacaac gtgctggtcg gcctctcgtg cggcctgcgc      1500
     ggcaaggcgc agatcggcaa gggcatgtgg gccatgcccg acctcatggc cgcgatgctc      1560
     gagcagaaga tcggccaccc caaggccggc gccaacaccg cctgggtgcc ctcgcccacc      1620
     gccgccacgc tgcacgcgct gcactaccac caggtgagcg tgaccgcggt gcagcaggag      1680
     ctggaaaaga tcgacgccga cgccgaacgc gacaacatcc tcaacgcgct gctgcaggtg      1740
     ccgatcgcgc ccgaagccaa gtggacggcc gaagagcgcc agcaggaaat cgacaacaac      1800
     gtgcagggca tcctcggcta cgtggtgcgc tggatcgacc agggcgtggg ctgctccaag      1860
     gtgcccgaca tccacaacgt gggcctcatg gaagaccgcg cgacgctgcg catctctagc      1920
     cagcacatcg ccaattggct gctgcacggc gtggtgacca aggcgcaggt cgacgagacc      1980
     ttccagcgca tggccaaggt ggtcgacgag cagaacgcag gcgacgcgct ctaccagccg      2040
     atggccggca acttcgcgac ctcggccgcg tacaaggcgg cacaggacct ggtgttcaag      2100
     ggcatcgagc agccgagcgg ctacaccgag ccgctgctgc atgcatggcg cctgaaggtc      2160
     aagggcgagg cctga                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page