(data stored in ACNUC1104 zone)

EMBL: CP002417.PE471

CP002417.PE471       Location/Qualifiers
FT   CDS_pept        511816..512793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0472"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="KEGG: cti:RALTA_A0774 histidinol-phosphate
FT                   aminotransferase; TIGRFAM: histidinol-phosphate
FT                   aminotransferase; PFAM: aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34694"
FT                   /db_xref="GOA:E6V4E8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E8"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADU34694.1"
FT                   /translation="MILLASNENPLGMPESARRAAAAALEGAGNYPDSNGTALKNALAA
FT                   RLDVSPEWLTLGSGSSEILELAAQVSLKPGENVVYSQYGFIVYAQATAHAHARASVVPS
FT                   QDFGHDLGAMRAAIADDTKLVFVANPNNPTGTFIDAGPLRDFLQSVPAHVTVLLDEAYT
FT                   EYLSPAQRYDSIEWVRRLPNLIVARTFSKAFGLAGMRIGYGVSQPPLTSRMNAQRPRFN
FT                   VTTPAQAAAVAALGDTEFLARTYELNTAGREQLAAGFTELGLVHIPSSGNFLMVQVGDA
FT                   QAVHARLLAAGIEVSLLGPYGLPQWLRVSVGLPEQNEALLAALR"
     atgatcctcc tggcttccaa cgaaaacccg ctcggcatgc ccgagtcggc ccgccgcgcc        60
     gcggccgccg ccctcgaagg cgccggcaac taccccgaca gcaacggcac cgcgctcaag       120
     aatgcactgg cggcccggct cgacgtgtcg cccgagtggc tcacgcttgg cagcggatcg       180
     agcgaaatcc tcgaactcgc cgcgcaggtg agcttgaagc cgggcgagaa cgtcgtctat       240
     tcgcagtacg gcttcatcgt ctacgcgcag gccacggcgc acgcccatgc gcgcgcctcc       300
     gtcgtacctt cgcaagattt cggccacgac ctgggcgcga tgcgcgccgc gatcgccgac       360
     gacacgaagc tggtcttcgt cgccaacccg aacaacccga ccggcacctt catcgatgct       420
     gggccgctgc gcgacttcct gcaatcggtg cccgcgcatg tgacggtgtt gctcgacgag       480
     gcctacaccg aatacctctc gcccgcgcag cgctacgaca gcatcgaatg ggtgcggcgc       540
     ctgccgaacc tgatcgtcgc gcgcaccttc tccaaggcct tcggcctcgc ggggatgcgc       600
     atcggctacg gcgtgtcgca gccgccgctg acctcgcgca tgaacgcgca acggccgcgt       660
     ttcaacgtga cgacgccggc ccaggccgcc gcagtggccg cgctcggcga cacggaattc       720
     ctcgcgcgca cctacgaact caacaccgcc ggacgcgagc aactcgccgc gggtttcacc       780
     gagttgggcc tcgtgcacat cccttcttcg ggcaactttc tcatggtgca ggtgggcgat       840
     gcgcaggccg tgcacgcgcg cctcttggcc gccggcatcg aggtttcgct gctcggcccc       900
     tacggcctgc cgcagtggct gcgcgtgagc gtgggcctgc ccgaacagaa cgaggcgctg       960
     ctcgccgcgc tgcgctga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page