(data stored in SCRATCH zone)

EMBL: CP002417.PE472

CP002417.PE472       Location/Qualifiers
FT   CDS_pept        complement(512922..513662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0473"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="KEGG: vap:Vapar_0454 transcriptional regulator, IclR
FT                   family; PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34695"
FT                   /db_xref="GOA:E6V4E9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4E9"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ADU34695.1"
FT                   /translation="MPRKAQTESVSDLNAAPGGAAAVDRALSLLSAFRPGDEALSLAQF
FT                   AERTQLYKSTALRLLASLEHARLIRRQDDGRYALGMEIARLHGLYAASQSLDRIVLPVL
FT                   RALAAATGESAAYHVRQDQGDGWVRLCQFRVDSSHVVRDHVRAGDLLPNDRGAGARVLI
FT                   AFGPDTERPRGARERKLYEAIRAQGCCALVGDRTAELAGISAPVFHADGSLAAAVTLTM
FT                   PTHRYDEGYIEPVRAAAKELSGQV"
     atgccccgca aagcccagac cgaatcggtt tccgacctca acgccgcacc cggcggtgcc        60
     gccgcggtcg atcgcgcgct gagcctgctg tcggcattcc ggccgggcga cgaagcgctg       120
     tcgctcgcgc agttcgccga gcgcacgcag ctctacaaga gcacggcgct gcggcttttg       180
     gcatcgctcg aacacgcgcg gttgatccgc cggcaggacg acggccgcta cgcgctcggc       240
     atggagatcg cgcggctgca tgggctctat gccgcgtcgc agtcgctcga ccgcatcgtg       300
     ctgccggtgc tgcgtgctct cgcagccgca accggagaaa gcgcggcgta ccacgtgcgg       360
     caggaccagg gcgacggctg ggtgcgcctg tgccagtttc gcgtcgactc atcgcacgtg       420
     gtgcgcgacc acgtgcgcgc gggcgacctg ttgcccaacg accgcggcgc cggtgctcgc       480
     gtgctgatcg ccttcggtcc cgataccgag cggccgcgcg gcgcgaggga acgcaagttg       540
     tatgaagcga tccgcgcgca aggctgctgc gcgctggtcg gggatcgaac ggccgaactc       600
     gcgggcatct cggcgccggt gttccatgcg gacggcagcc ttgctgcggc ggtcacgctg       660
     acgatgccga cgcatcgcta tgacgagggc tacatcgaac ccgtgcgcgc ggcggcgaag       720
     gaactcagcg ggcaggttta g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page