(data stored in ACNUC1104 zone)

EMBL: CP002417.PE476

CP002417.PE476       Location/Qualifiers
FT   CDS_pept        516936..517388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0477"
FT                   /product="Protein of unknown function DUF2214, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2214, membrane;
FT                   KEGG: vap:Vapar_0458 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34699"
FT                   /db_xref="GOA:E6V4F3"
FT                   /db_xref="InterPro:IPR018706"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F3"
FT                   /inference="protein motif:PFAM:PF09980"
FT                   /protein_id="ADU34699.1"
FT                   /translation="MTLEAILAYVHLLAILTMVVFISSEAALCRVQWLNAAVVERLAKV
FT                   DMVYGIAAIAVLATGIARTWWGVKGTAWYWTNPLLHVKLGLFIIVGVLSIFPTLTYFRW
FT                   RKTLRSTGKLPVEADIKKTRKLVMVQAHLIALIPLVAVFLARGFGK"
     atgaccctcg aagccatcct cgcctacgtg cacttgctcg ccatcctcac gatggtcgtg        60
     ttcatctcca gcgaggccgc cctgtgccgc gtgcagtggc tcaacgccgc ggtcgtcgag       120
     cggctcgcca aggtcgacat ggtctacggc atcgccgcca tcgcggtgct cgcgaccggc       180
     atcgcgcgca cctggtgggg cgtgaagggc acggcctggt actggaccaa cccgctgctg       240
     cacgtgaagc tggggctctt catcatcgtg ggcgtgctgt cgatctttcc gacgctcacc       300
     tatttccgct ggcgcaagac gctgcgttcc accggcaagc tgccggtcga ggccgacatc       360
     aagaagacgc gcaagctggt gatggtgcag gcccacctga tcgcgctgat cccgctggtc       420
     gccgtgttcc tggcgcgcgg cttcggcaag taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page