(data stored in SCRATCH zone)

EMBL: CP002417.PE479

CP002417.PE479       Location/Qualifiers
FT   CDS_pept        519646..520413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0480"
FT                   /product="Sporulation domain-containing protein"
FT                   /note="PFAM: Sporulation domain-containing protein; KEGG:
FT                   vap:Vapar_0462 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34702"
FT                   /db_xref="GOA:E6V4F6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F6"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADU34702.1"
FT                   /translation="MKKTTRQRGNIVIGLIIGLVIGLGVALGIAVYVTKVPIPFVNKTQ
FT                   KGGAEQDEAEARKNRDWDPNAPLAGKAGAAKPTPPAATGPVNPVTGEPATSTTAVAPGT
FT                   PPPATAPVPVVVAPKPTRAVPVPAEANALPASNDPLGDLARARAGTGSGSTTVASAVPS
FT                   SNANNSAAASSGADPFMYFVQAGAFRTTDDAEAQRAKLSLMGVEARVTEREQAGRTVYR
FT                   VRAGPFNKKDDADRLKERLDGGGLESALVRVQR"
     atgaagaaga caaccagaca acgcggcaac atcgtcatcg gcctgatcat cgggctggtg        60
     atcggcctgg gcgtggcgct gggcatcgcg gtctacgtga ccaaggtgcc gatcccgttc       120
     gtgaacaaga cgcaaaaggg cggcgccgag caggacgaag ccgaggcccg caagaaccgc       180
     gactgggacc ccaacgcgcc gctggccggc aaggccggcg ccgccaagcc gacgccgccg       240
     gccgccaccg gtccggtcaa cccggtcacc ggcgaacccg ccaccagcac caccgccgtc       300
     gcacccggca cgccgccccc ggccaccgca ccggtgcccg tggtggttgc gcccaagccg       360
     acgcgtgcgg tgcccgtgcc ggccgaagcc aatgcgctgc cggcgtcgaa cgatccactg       420
     ggcgacctgg cccgtgcccg cgcgggcacc ggctcgggca gcacgaccgt ggcatccgcc       480
     gtgccgagca gcaacgccaa caacagcgcc gcggcgtctt ccggcgccga tccgttcatg       540
     tacttcgtgc aggccggcgc cttccgcacc accgacgacg ccgaggcgca gcgcgccaag       600
     ttgtcgctga tgggcgtcga ggcccgggtc accgagcgcg agcaggctgg ccgcacggtc       660
     taccgcgtgc gcgccggtcc gttcaacaag aaggacgatg ccgaccgcct caaggagcgg       720
     ctcgatggcg gcggcctcga atcggccctg gtccgcgtgc agcgctga                    768
//

If you have problems or comments...

PBIL Back to PBIL home page