(data stored in ACNUC1104 zone)

EMBL: CP002417.PE480

CP002417.PE480       Location/Qualifiers
FT   CDS_pept        520574..521221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0481"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: vap:Vapar_0463 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34703"
FT                   /db_xref="GOA:E6V4F7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F7"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADU34703.1"
FT                   /translation="MKRRDFSLAATSLGLLSLAANPAHAQARMPKAGSEYLVLDKRVPV
FT                   DAPAGKVEVVEFFSYNCPHCNDFEPALEAWAKTAPKEVAFRRIPVPFVGNDVEAKQRLY
FT                   YALEAMGKVDEFQPKVFNAIHKQRQNVNGDANIIAWVAANGIDGTKFKEVFTSFGVASK
FT                   AKRASQMTDAYKVAGVPAMAVAGRWYVDGETAGNMTNVLQVVNFLVGEAKKG"
     atgaaacgtc gtgacttttc gctggccgcc acttcgctcg ggctgctttc gctggccgcc        60
     aatccggccc acgcccaggc gcgcatgccc aaggccggct ccgagtacct tgtgctcgac       120
     aagcgcgtgc ctgtcgatgc accggccggc aaggtcgagg tggtcgagtt cttctcgtac       180
     aactgccctc attgcaacga cttcgagccc gcgctcgaag cctgggccaa gacggcaccc       240
     aaggaagtcg ccttccgccg catcccggtg cctttcgtgg gcaacgacgt cgaagccaag       300
     cagcgcctgt actacgcgct cgaggcgatg ggcaaggtcg acgaattcca gccgaaggtc       360
     ttcaacgcga tccacaagca gcgccagaac gtgaatggcg atgccaacat cattgcctgg       420
     gtcgctgcca acggtatcga cggcaccaag ttcaaggaag tcttcacctc gttcggcgtg       480
     gccagcaagg ccaagcgcgc ctcgcagatg accgacgcct acaaggtggc tggcgtcccg       540
     gcgatggccg tggccggccg ctggtacgtg gatggcgaga ccgccggcaa catgaccaac       600
     gtgctgcaag tggtcaactt cctggtcggc gaagcaaaga agggctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page