(data stored in SCRATCH zone)

EMBL: CP002417.PE481

CP002417.PE481       Location/Qualifiers
FT   CDS_pept        521416..522132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0482"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="KEGG: vap:Vapar_0464 lipopolysaccharide transport
FT                   periplasmic protein LptA; TIGRFAM: lipopolysaccharide
FT                   transport periplasmic protein LptA; PFAM: OstA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34704"
FT                   /db_xref="GOA:E6V4F8"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4F8"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ADU34704.1"
FT                   /translation="MTLPSYPNNTPLVRRIGRLAIGALLLAGLASGVLAETADRSKPMN
FT                   IESDAMRYDDLKQTSVFTGNVLVTKGTIIIRGARLDVRQDAEGYQYGVVTAAPGKRAYY
FT                   KQKRNAPDEWIEGESEVIEYDSRADNVKFIRNATMRRLLGATPNDESQGALIVYDQSND
FT                   TYTVNGSTVPPNTAVNASTPTGRVKTILTPKAATAPKPGASAPAGAKPAAPASTPAPGT
FT                   GLRSTTTLSGEGEGRK"
     atgacattgc cctcctaccc aaacaacacc cccctcgttc gtcgcatcgg ccgcctggcc        60
     atcggcgcgc tgttgctggc cggcctcgcc tcgggcgtcc tggccgagac cgccgaccgc       120
     agcaagccga tgaacatcga gtcggacgcc atgcgctacg acgacctgaa gcagaccagc       180
     gtgttcaccg gcaacgtgct cgtcacgaag ggcacgatca tcatccgcgg cgcgcgcctc       240
     gatgtgcgcc aggatgccga gggctaccag tacggcgtgg tcaccgcggc acccggcaag       300
     cgcgcttact acaagcagaa gcgcaatgcg cccgacgagt ggatcgaggg cgaatccgaa       360
     gtcatcgaat acgacagccg cgccgacaac gtcaagttca tccgcaacgc caccatgcgc       420
     cggctgctcg gcgccacgcc gaacgacgaa agccagggcg cgctgatcgt ctacgaccag       480
     agcaacgaca cctacaccgt caacggttcg accgtgccgc cgaacaccgc ggtgaacgca       540
     tcgaccccca ccggccgcgt caagaccatc ctcacgccca aggccgccac cgcgccgaag       600
     cccggcgcct cggcaccggc cggcgcgaag cccgcggcac cggcttccac ccccgcgccc       660
     ggcaccggcc tgcgctcgac caccacgctg agtggagagg gagaagggcg caagtga          717
//

If you have problems or comments...

PBIL Back to PBIL home page