(data stored in SCRATCH zone)

EMBL: CP002417.PE483

CP002417.PE483       Location/Qualifiers
FT   CDS_pept        522942..524531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0484"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="KEGG: vap:Vapar_0466 RNA polymerase, sigma 54
FT                   subunit, RpoN; TIGRFAM: RNA polymerase sigma-54 factor,
FT                   RpoN; PFAM: sigma-54 DNA-binding domain protein; sigma-54
FT                   factor; sigma-54 factor core-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34706"
FT                   /db_xref="GOA:E6V4G0"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G0"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADU34706.1"
FT                   /translation="MKQGLSLRVSQHLALTPQLQQSIRLLQLSTLELSQEVEQMLDENP
FT                   FLERTAEEAAREEFGLDAVDTPVPRDDGGETGEGDFAPVSTSSATTTTETSSTPDSDGP
FT                   AAEITEREPDWEGDGTVDMAPDDSEWGSDAPARQNNLGDDERADATELARSQESLQSFL
FT                   HRQALSLRLNENDSAALRFLIESLNDDGYLEDSLPALASGLAGDDNDQFDDLVHHFQVA
FT                   LGLLQSLEPAGVGARDLGECLGIQLRALASEDETEDEELIRKTAIAICKQPMELLARRD
FT                   FKRLATLTRTNEELVRSALQIIARLEPKPGRRFVDVERNIVIPDVIVTKTGRGTNIKFR
FT                   VMLNPEVMPRLRVHDIYAGALKSHKGEGSQALSQRLQEARWFIKNIQQRFDTILRVSNA
FT                   IVERQKSYFVHGELAMRPLVLREIADELGLHESTISRVTTAKYMSTPFGTVELKYFFGS
FT                   ALGTETGGNASSTAVRALIKQFVSSESIKKPLSDSQISEMLKEQGIECARRTVAKYREA
FT                   LRIAPANLRKAL"
     atgaagcaag ggctgtccct tcgcgtctcg cagcatctgg cgctcacgcc acaactgcag        60
     cagtcgatcc ggctgctgca gctctccacg ctcgaactga gccaggaggt cgagcagatg       120
     ctggacgaga acccgttcct cgagcgcacc gctgaagaag cggcgcgcga ggaattcggg       180
     ctcgatgccg tcgacacgcc ggtgccgcgc gacgacggcg gtgaaaccgg cgaaggcgat       240
     ttcgccccgg tctcgaccag cagtgcgacg accacgaccg agacctcctc cacgcccgac       300
     tccgacggcc ctgccgccga gatcaccgag cgcgagcccg actgggaagg cgacggcacc       360
     gtcgacatgg cgcccgacga cagcgagtgg ggcagcgacg cccccgcgcg ccagaacaac       420
     ctgggcgacg acgaacgcgc cgacgccacc gaacttgcgc gcagccagga gtcgctgcag       480
     tcgttcctgc accgccaggc gctgagcctg cgcctgaacg agaacgacag cgctgcgctg       540
     cgcttcctca tcgagtcgct caacgacgac ggctacctcg aagactcgct ccccgcgctg       600
     gcctcgggcc tcgcgggcga cgacaacgac cagttcgacg acctcgtgca tcacttccag       660
     gtggcactcg ggctgctgca gagcctggag cctgccggcg tcggtgcgcg cgacctgggc       720
     gaatgcctgg gcatccagct gcgcgcgctc gccagcgaag acgagaccga ggacgaagaa       780
     ctcatccgca agaccgccat cgcgatctgc aagcagccga tggagctgct cgcgcggcgc       840
     gacttcaagc gcctggccac gctcacgcga accaacgaag aactggtgcg ctcggcgctg       900
     cagatcattg cgcgactgga gcccaagccg ggccggcgct tcgtcgacgt cgagcgcaac       960
     atcgtcattc ccgacgtgat cgtcaccaag acgggccgcg gcaccaacat caagttccgc      1020
     gtcatgctga accccgaggt gatgccgcgc ctgcgcgtgc acgacatcta cgcgggcgcg      1080
     ctcaagtcgc acaagggcga gggcagccag gcgctctcgc agcggctgca ggaggcgcgc      1140
     tggttcatca agaacatcca gcagcgcttc gacaccatcc tgcgcgtgag caacgccatc      1200
     gtcgagcgcc agaagagcta cttcgtgcac ggcgagctcg cgatgcgccc gctggtgctg      1260
     cgcgagatcg ccgacgagct gggcctgcac gaatcgacca tctcgcgcgt gaccaccgcc      1320
     aagtacatgt ccacgccgtt cggcacggtc gaactcaagt acttcttcgg ctcggcgctc      1380
     ggcaccgaga ccggcggcaa cgcatcgagc accgcggtgc gcgcgctcat caagcagttc      1440
     gtgagctccg agagcatcaa gaagccgctg tcggacagcc agatctccga gatgctgaag      1500
     gagcagggca tcgagtgcgc gcgccgcacc gtggccaagt accgcgaggc gctgcgcatc      1560
     gcgcccgcca accttcgcaa agccctttag                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page