(data stored in SCRATCH zone)

EMBL: CP002417.PE484

CP002417.PE484       Location/Qualifiers
FT   CDS_pept        524542..526143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0485"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="KEGG: vap:Vapar_0467 phospholipase
FT                   D/transphosphatidylase; PFAM: phospholipase
FT                   D/Transphosphatidylase; SMART: phospholipase
FT                   D/Transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34707"
FT                   /db_xref="GOA:E6V4G1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G1"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADU34707.1"
FT                   /translation="MTRRLLSRCGHWVFAMATVLLFAGCATLPDEAPRAPAKAMGVSAD
FT                   TALGKIALASQPDPDLSGFRLMPGGDFAFDTRIQLARRAQRTLDVQYYQIENDETGRYL
FT                   LRTLRDAAQRGVRVRLLMDDLYTSGEDELLLGLAATPNVELRLFNPFPAGRGSLLKRFT
FT                   ASLFDFSRVNRRMHNKLFIADGAMAVAGGRNIGNQYFTRTSGENFIDLDTFVTGALIPR
FT                   LGVLFDQYWNSVYVRPVQSIIASDLSREELQRRFEAATGPDTTPPPPKPAPNDLLGYSP
FT                   MADDLNAGKLGLIWTLAEAYADSPERVIGKTASYGGVPLLDVDSVRYNVVEQMRRARSE
FT                   VTIVSPYLIPGAAGLEVMKEIRGRNVKISVVTNSLAATDEPLVHTAYRRYRPEMLKLGA
FT                   DLYELSTTRTRRSVRLGLFGTSVGRLHAKSAVIDQRILFVGSMNFDPRSETHNTEIGLF
FT                   IRSAEMAQQALKLIDVLKQQGAYRLRFVEGSGESHIEWTSEDAGKTTVLNEEPDSGFWD
FT                   RTMLELLAPLTPESLL"
     atgacccgtc gcctgctgtc gcgttgtggg cactgggtct tcgccatggc gaccgtgttg        60
     ctgttcgcgg gttgcgcgac cttgcccgac gaggcgccgc gtgcgcccgc caaggccatg       120
     ggcgtctcgg ccgacaccgc gctcggcaag atcgcgctgg cctcgcagcc cgaccctgac       180
     ctcagcggtt tccgcttgat gcccggcggc gacttcgcct tcgacacccg catccagctc       240
     gcgcgccgcg cccagcgcac gctcgacgtg cagtactacc agatcgagaa cgacgaaacc       300
     ggccgctatc tcttgcgcac cctgcgcgat gcggcccagc gcggcgtgcg cgtgcgcctc       360
     ctgatggacg acctctacac gtccggcgaa gacgaacttt tgctcggcct ggccgccacg       420
     ccgaatgtcg agctgcgcct cttcaaccca ttcccggccg gacgcggcag cctgctcaag       480
     cgcttcaccg cgtcgctctt cgacttcagc cgcgtcaacc gccgcatgca caacaagctc       540
     ttcatcgccg atggtgcgat ggcggtggcg ggcggccgca acatcggcaa ccagtacttc       600
     acccgaacct cgggcgagaa cttcatcgac ctcgacacct tcgtgacggg cgcgctgatc       660
     ccgcgcctgg gcgtcttgtt cgaccagtat tggaacagcg tctacgtgcg gccggtgcag       720
     tcgatcatcg cgagcgacct ttcgcgcgag gaactgcaaa ggcgcttcga agccgccacc       780
     ggccccgaca ccacgccccc gccgccgaag cccgcgccca acgacctgct cggctacagc       840
     ccaatggcgg acgacctgaa cgccggcaag ctcggcctga tctggaccct cgccgaggca       900
     tacgccgatt cgcccgagcg cgtgatcggc aagaccgcgt cgtacggcgg cgtgccgctg       960
     ctcgatgtcg acagcgtgcg ctacaacgtg gtcgagcaga tgcgccgtgc gcgcagcgag      1020
     gtgaccatcg tgtcgcctta tctcatcccg ggcgccgcgg ggctggaggt gatgaaggag      1080
     atccgtgggc gcaacgtgaa gatcagcgtg gtcaccaatt cgctcgccgc cacggacgag      1140
     ccgctggtgc acaccgccta ccgccgctac cgccccgaga tgctcaagct cggcgccgac      1200
     ctctacgagc tgagcaccac gcgcacgcgg cgcagcgtgc ggcttgggct gttcggtact      1260
     tcggtgggcc ggctgcatgc gaagtcggcc gtcatcgacc aacgcatcct tttcgtcggc      1320
     tcgatgaatt tcgatccgcg ctcggagacg cacaacaccg agatcggcct cttcatccgc      1380
     agcgccgaga tggcgcagca agcgctcaag ctcatcgatg tgctcaagca gcagggcgcc      1440
     taccggctgc gctttgtcga aggcagtggc gaatcgcaca tcgagtggac cagcgaagac      1500
     gcgggcaaga ccacggtgct gaacgaggag cccgactccg gcttctggga ccgaacgatg      1560
     ctcgaactgt tggcgccgct gacgccggag agcctgctgt ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page