(data stored in SCRATCH zone)

EMBL: CP002417.PE485

CP002417.PE485       Location/Qualifiers
FT   CDS_pept        complement(526263..526910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0486"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   vap:Vapar_0468 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34708"
FT                   /db_xref="GOA:E6V4G2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G2"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ADU34708.1"
FT                   /translation="MMDTTLSLLGIAGAMTVGAMSPGPSFVMVARTAVASRSDGLAAAL
FT                   GMGAGGLVFAIAALAGLQAAFLAVPGLYLAIKGFGGAYLIYLGFLIWRGARQPLAMTQD
FT                   ADASSTPQQGRGRRTFLLGLATQVSNPKTAVVYASIFAAFLPREVPLVLALAVPVVIFC
FT                   IETGWYAIVALALSSAAPRSAYLRYKVWIDRAAGGVMGLLGLRLVWSAVSES"
     atgatggaca ccaccctctc cctgctgggc atcgccggcg ccatgaccgt cggcgccatg        60
     agcccgggcc ccagcttcgt catggtcgcg cgcacggccg tggcttcgcg cagcgacggg       120
     cttgcggctg ctctgggcat gggcgcgggc ggcctcgtgt tcgcgattgc cgcactggcg       180
     ggattgcagg cggcgttcct cgcggtgccg gggctttacc tcgcgatcaa gggcttcggc       240
     ggcgcgtacc tgatctacct gggctttctc atctggcgcg gtgcgcggca gccgcttgca       300
     atgacgcagg atgcggacgc gtcatcgact ccgcaacagg gccgcggccg ccgcactttc       360
     ctgctcggat tggcgacgca ggtcagcaac ccgaagacgg ccgtggtgta cgcgagcatc       420
     ttcgcggcct tcctgccgcg cgaggtgccg ctggtgctgg cgctcgcagt gccggtggtc       480
     atcttctgca tcgagaccgg ctggtacgcg atcgtcgcgc tcgcgctgtc gtcggcggcc       540
     ccgcgttcgg cctacctgcg ctacaaggtc tggatcgacc gcgcggccgg tggcgtgatg       600
     gggttgctgg gcctgcggct ggtgtggtcg gccgtgagcg aaagctga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page