(data stored in SCRATCH zone)

EMBL: CP002417.PE486

CP002417.PE486       Location/Qualifiers
FT   CDS_pept        complement(526924..527577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0487"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: vap:Vapar_0469 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34709"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G3"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADU34709.1"
FT                   /translation="MSLIPYAMKKLLLASALSAAALPFAAIAQEYTAPAVAAKPAGGPV
FT                   KNGNYVIDPTHTFVMYEMGHYGTTTNRGRFSTKDGSVQIDGSGTSGKVDITMDIGTINT
FT                   GVDLLNRHVQSKDFFNVAEFPTGRFVADRIEFSGDKVVDVPGTLTLMGQTKPVTLKAVR
FT                   FNCYLNPLINRQVCGGDFETTVQRSDWGINWGLNFGFENKVKLLVQVEAVNVQQ"
     atgtccctca ttccttacgc catgaagaag ctccttctcg cctcggcgct ctccgccgcc        60
     gccctcccgt tcgccgccat cgcgcaggaa tacacggccc ccgccgtcgc cgccaagccc       120
     gcgggcggcc cggtgaagaa cggcaactac gtcatcgacc ccacgcacac cttcgtgatg       180
     tacgagatgg gccactacgg caccaccacc aaccgcggcc gcttcagcac caaggacggc       240
     tcggtgcaga tcgacggctc gggcacgagc ggcaaggtcg acatcaccat ggacatcggc       300
     accatcaaca ccggcgtcga cctgctcaac cgccacgtgc agagcaagga cttcttcaac       360
     gtcgccgaat tccccaccgg ccgtttcgtg gccgaccgca tcgagttcag cggcgacaag       420
     gtggtcgacg tgccgggcac cctcacgctc atgggccaga ccaagccggt gacgctgaag       480
     gccgtgcgct tcaactgcta cctgaacccg ctgatcaacc gccaggtctg cggcggcgac       540
     ttcgagacca ccgtgcagcg cagcgactgg ggcatcaact ggggactgaa cttcggcttc       600
     gagaacaagg tgaagctgct ggtgcaggtg gaagcggtga acgtgcagca atga             654
//

If you have problems or comments...

PBIL Back to PBIL home page