(data stored in ACNUC1104 zone)

EMBL: CP002417.PE488

CP002417.PE488       Location/Qualifiers
FT   CDS_pept        complement(528210..528791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0489"
FT                   /product="cytochrome b561"
FT                   /note="KEGG: vap:Vapar_0471 cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34711"
FT                   /db_xref="GOA:E6V4G5"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G5"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0471"
FT                   /protein_id="ADU34711.1"
FT                   /translation="MSADTPLPPLSAVARGQRYGTVAIVLHWLLAAMIVGSLGVGLYMT
FT                   GLPFSPLRIKLYNWHKWAGVTILLLSAVRLLWRLAHRPPAVPAQVLAAMPRWQIAGYRA
FT                   SHAAMYLLFFAVPLFGWAYTSALGIPVVWFGVLPLPDFVPVDKDLAEAILKPLHKGSAY
FT                   TLAAVALLHVAAALKHHWIDRDDLLKRMWP"
     atgtctgccg acacccctct tcctcctctt tccgccgtcg cgcgcggcca gcgctatggc        60
     accgtggcca tcgtgctgca ctggctgctc gcggcaatga tcgtcggctc gctcggcgtg       120
     gggctctaca tgacggggct gccgttctcg ccgctgcgca tcaagctcta caactggcac       180
     aagtgggccg gcgtcacgat cctcctgctg tcggctgtgc ggctcctgtg gcggcttgcg       240
     caccgtccgc ccgcggtgcc ggcgcaggtg ctggccgcca tgccgcgctg gcaaatcgcg       300
     ggctaccggg ccagccacgc ggcgatgtac ctgctgttct tcgcggtgcc gctgttcggc       360
     tgggcctaca cctcggcgct gggcattccg gtcgtgtggt tcggcgtgct gccgctgccg       420
     gatttcgtgc cggtcgacaa ggacctcgcc gaggccatac tcaagccgct gcacaagggc       480
     agcgcctaca cgctggcggc ggtggcgctg ctgcacgtgg cggccgccct gaagcaccac       540
     tggatcgacc gcgacgacct gctcaagcgc atgtggccct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page