(data stored in ACNUC1104 zone)

EMBL: CP002417.PE489

CP002417.PE489       Location/Qualifiers
FT   CDS_pept        complement(528874..530664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0490"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="KEGG: vap:Vapar_0472 histidine kinase; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34712"
FT                   /db_xref="GOA:E6V4G6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADU34712.1"
FT                   /translation="MTPTPAPSVAPAADASSDRFAIQCEVLRLSIRPIGPVLLVQYLLN
FT                   CGVAALFAWQYSLVRALVWIALITGVTVMRGFFPQRLPDPFTPESLRHAQRAHTLRTAV
FT                   WELAHGLAGVLLFNPERPDQQLLLGLMLMGMTLSSAFSVSFYTPATQLAITLLLAPVIV
FT                   TGLTLGAPTMMAVSVIGIGLTAMMWKLVAERSRQLEENIGLRLNERTLREQALAGLRAS
FT                   EQAQAERLRFFSAANHDLRQPVMAIGLQAEVLRQQLDTGADASAVQHTVVSLARAQQAL
FT                   EGLTNQLLEIGRIEAAVDPLRPVAVALAPLLQDLARQAGNGRVTVRCPAGAVAWTDAVS
FT                   LRRVLANLVDNAVKFTPRGRVLLAVRARHRGTERAWRVEVRDSGIGIAADSQERVFNDF
FT                   EQIGNAERNLQHGHGLGLAIVRRLAAQLGIEVSLRSAPGRGSVFGFELPAAQGYGAAAL
FT                   QPAPPPQASPEAAPALRPGLAVLVVEDNAVVADSLYALLRQWEVSPRVYASAAEALALA
FT                   DLRALDAALCDIRLPGALDGIALAERLQAQNPALTIALISADINEATQRLATERGWHAL
FT                   RKPVQPEELRGVLLRAPQRP"
     atgactccca cccccgcacc ttcggtcgcc ccggccgccg acgccagcag cgaccgcttc        60
     gcgatccagt gcgaggtgct gcggctctcg atccggccca tcgggccggt gctgctggtg       120
     cagtacctgc tcaattgcgg cgtggcggcg ctcttcgcct ggcagtactc gctggtgcgc       180
     gcgctggtgt ggatcgcgct catcaccgga gtcacggtga tgcgcggctt cttcccccag       240
     cgcctgcccg atcccttcac gcccgaaagc ctgcgccacg cacagcgcgc gcacacgctg       300
     cgcaccgccg tctgggagct ggcgcacggg ctggccggcg tgctgctctt caatcccgag       360
     cggcccgacc agcaactctt gctcggcctg atgctgatgg gcatgacgct gtcgtcggcg       420
     ttctcggtgt cgttctacac gccggccacg caactggcga tcacgctgct gctcgcgccg       480
     gtgatcgtga ccggcctcac gctgggtgcg ccgaccatga tggctgtctc ggtgatcggc       540
     atcggactca cggccatgat gtggaagctg gtggccgagc gctcgcgcca gctcgaggag       600
     aacatcggcc tccgcctgaa cgagcgcacg ctgcgcgaac aggcgctcgc gggcctgcgc       660
     gcttccgagc aggcgcaggc cgaacggctg cgcttcttct ccgccgccaa ccacgacctg       720
     cgccagccag tgatggccat cggcctgcag gccgaggtgc tgcgccagca actggacacc       780
     ggcgcggacg ccagtgcggt gcagcacacc gtggtctcgc tcgcgcgggc gcagcaggcg       840
     ctggaagggc tcaccaacca gttgctcgaa atcggccgca tcgaagccgc ggtcgatccg       900
     ctgcggcctg tggcggtggc gctggccccc ttgctgcagg acctcgcgcg ccaggccggc       960
     aacggccgcg tgacggtgcg ctgcccggcc ggcgcggtgg cgtggaccga cgccgtgtcg      1020
     ctgcgccgcg tgctggccaa cctggtcgac aacgccgtca agttcacgcc gcgcggccgc      1080
     gtgctgctgg cggtgcgggc gcggcaccgg ggcacggaac gggcctggcg cgtcgaggtg      1140
     cgcgacagcg gcatcggcat cgcggcggat tcgcaggagc gcgtgttcaa cgacttcgag      1200
     cagatcggca acgcggagcg caacctgcag cacggccatg gcctgggcct cgcgatcgtg      1260
     cggcggctgg cggcgcaact gggcatcgag gtgtcgctgc gctcggcgcc gggccggggc      1320
     tcggtgttcg gcttcgagct gcccgcggcg cagggctatg gcgcggcggc gttgcagccg      1380
     gcgcccccac cgcaggcgag cccggaagcc gcccccgcat tgcgccccgg cctcgccgtg      1440
     ctggtggtgg aagacaacgc cgtggtggcc gacagcctgt atgcgctgct gcggcagtgg      1500
     gaggtgtcgc cgcgcgtcta cgccagcgcc gccgaggcgc tggcgctggc cgacctgcgc      1560
     gccctcgatg cggcgctgtg cgacatccgc ctgccgggcg cgctcgacgg catcgcgctg      1620
     gcagagcggc tgcaggcgca gaacccggca ctcaccatcg cgctgatctc cgccgacatc      1680
     aacgaggcca cacagcgact ggccaccgag cgcggctggc atgcgctgcg caagcccgtg      1740
     cagccggagg agctgcgcgg cgtgctgctg cgcgcgccgc agcggccctg a               1791
//

If you have problems or comments...

PBIL Back to PBIL home page