(data stored in ACNUC1104 zone)

EMBL: CP002417.PE49

CP002417.PE49        Location/Qualifiers
FT   CDS_pept        51358..52245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0049"
FT                   /product="transglutaminase domain-containing protein"
FT                   /note="KEGG: pol:Bpro_0068 transglutaminase-like; PFAM:
FT                   transglutaminase domain-containing protein; SMART:
FT                   transglutaminase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34272"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS8"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ADU34272.1"
FT                   /translation="MHISHIDAQLDYEVTAPAHMLLNIEAARSGAQAVVEETLTIEPPT
FT                   EMQVFCDEGSGNRFIRFDAKPGSLKIGYRATVQRSHVHVPPDLCEVPVNEVPDEVLHYM
FT                   MPTRYCESDLMSRCAQQLFGELPPGIGRVQAIVDWIHDSIAYEPGSTDSTTTAREVFVE
FT                   RAGVCRDFAHLGITFCRALNIPARLVVGYVWFDEPPQDFHAVFEAWLGGQWVLFDPTRM
FT                   APVDRLVRVGTGRDAKDVAFCTIFGAVRMTDKKLVVRELQDESVPPPAAPAPSGALVGI
FT                   EKPVPVTQLAETTA"
     atgcacatct cccacatcga cgcgcaactc gactacgagg tgacggcgcc cgcgcacatg        60
     ctgctcaaca tcgaggccgc gcggtcgggc gcacaagcgg tggtcgagga gacactgacc       120
     atcgagccgc cgaccgagat gcaggtgttc tgcgacgagg gcagcggcaa tcgcttcatc       180
     cgcttcgatg cgaagcccgg gtcgctgaag atcggctaca gggcgacggt gcagcgctcg       240
     cacgtgcacg tgccgccgga cctctgcgag gtgccggtca acgaagtgcc cgacgaggtg       300
     ctgcattaca tgatgccgac gcgctactgc gagtcggacc tgatgtcgcg ctgcgcgcag       360
     cagctcttcg gcgaactgcc gccgggcatc gggcgcgtgc aggcgatcgt cgactggatt       420
     cacgacagca tcgcctacga gcccggcagc accgactcga ccacgaccgc gcgtgaggtg       480
     ttcgtggaac gcgcgggcgt gtgccgcgac ttcgcgcacc tgggcatcac cttctgccgt       540
     gccctcaaca ttccggcgcg gctggtggtg ggctatgtgt ggttcgacga gccgccgcag       600
     gatttccatg cggtgttcga agcctggctc ggtgggcagt gggtgctgtt cgatccgacc       660
     cgcatggcgc cggtcgaccg gctggtgcgc gtaggcaccg ggcgcgacgc gaaggacgtg       720
     gccttctgca cgatcttcgg cgcggtgcgc atgacggaca agaagctcgt ggtgcgcgag       780
     ctgcaggacg aaagcgttcc accgcctgcc gcaccggccc cgagcggcgc gctggtcggc       840
     atcgaaaagc cggtgccggt aacccaactg gccgaaacca ccgcctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page