(data stored in SCRATCH zone)

EMBL: CP002417.PE490

CP002417.PE490       Location/Qualifiers
FT   CDS_pept        530707..531969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0491"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="KEGG: vap:Vapar_0473 putative RNA methylase; PFAM:
FT                   RNA methylase; THUMP domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34713"
FT                   /db_xref="GOA:E6V4G7"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G7"
FT                   /inference="protein motif:PRIAM:2.1.1.52"
FT                   /protein_id="ADU34713.1"
FT                   /translation="MESPLVGLPDGQFPVNDLSFFLPCAAGVEEFLAQEVHALTGRVGQ
FT                   DLLTLRGGVRVRADWRDALKLNLHSRLAQRVLVELAHAPYRNENDLYAIASGVAWEIWF
FT                   TPKQTFKIETTAQHSPLQSLNFATLRIKDAIADRFRAKANGVRPSIETQWPDTRVFAHL
FT                   TTEHCTLYIDTSGEPLFKRGWRQDKGDAPLKETLAAAMLAASGWWNPETGTVSEQPLYD
FT                   PCCGSGTIPIEAAQIARGIAAGSLRRFGFEKLLPFQAHVWDAIKKESLLAVKPGSVAIF
FT                   GSDVSHRMVDFAERNAERAGVADAIEFRGGDALQRMPPAEGGVVMLNPPYGERIEVGGV
FT                   ARAGAREAAQTEEGDGSEFFPQLATHWKKNYAGWTAWVLTPDLKLPKQMRLKESRRVPM
FT                   WNGPIECRLFRFDMVAGSARK"
     atggagtccc ccctagtcgg gcttcccgat ggccaatttc ctgtgaacga tctttccttt        60
     ttcctgcctt gcgccgccgg cgtcgaggaa ttcctggccc aagaggtgca cgccctgacg       120
     ggccgcgtcg ggcaagacct gctcacgctg cgcggcggcg tgcgggtgcg tgccgactgg       180
     cgcgacgccc tgaagctcaa cctgcacagc cgccttgcgc agcgcgtgct ggtcgagctg       240
     gcccatgcgc cctaccgcaa cgagaacgac ctgtacgcca ttgcgagcgg cgtggcctgg       300
     gagatctggt tcacgcccaa gcagaccttc aagatcgaga ccaccgccca gcacagcccg       360
     ctgcagagcc tgaatttcgc caccctgcgc atcaaggatg cgattgccga ccgcttccgc       420
     gccaaggcca acggcgtgcg cccgagcatc gagacccagt ggcccgacac ccgcgtgttc       480
     gcccacctga ccaccgagca ctgcacgctc tacatcgaca cctccggcga gccgctgttc       540
     aagcgcggct ggcgccagga caagggcgac gccccgctga aggaaaccct tgccgccgcg       600
     atgctggccg ccagcggctg gtggaacccc gagaccggca ccgtgtcgga gcagccgctg       660
     tacgacccct gctgcggcag cggcaccatc cccatcgagg cggcgcagat cgcgcgcggc       720
     atcgcggccg gatcgctcag gcgcttcggt ttcgagaagc tgctgccgtt ccaggcgcac       780
     gtgtgggacg cgatcaagaa ggaatcgctc ctggccgtga agccgggcag tgtcgcgatc       840
     ttcggctccg acgtgtcgca ccgcatggtc gactttgccg agcgcaacgc ggagcgcgcc       900
     ggcgtcgccg atgccatcga gttccgcggc ggcgacgcgc tgcagcgcat gccgccggcc       960
     gagggcggcg tggtcatgct caatccgccc tacggcgagc ggatcgaagt cggcggcgtg      1020
     gcccgcgcgg gtgcgcgcga agccgcgcag accgaagagg gcgatggcag cgagttcttc      1080
     ccccaactcg ccacccattg gaagaagaac tatgccggct ggacggcctg ggtcctcacg      1140
     ccggacctga agctgcccaa gcagatgcgg ctgaaggaat cgcgccgcgt gccgatgtgg      1200
     aacgggccga tcgaatgccg gctgttccgc ttcgacatgg ttgccgggtc cgcgcggaag      1260
     tag                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page