(data stored in ACNUC1104 zone)

EMBL: CP002417.PE491

CP002417.PE491       Location/Qualifiers
FT   CDS_pept        complement(532105..532527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34714"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G8"
FT                   /inference="similar to AA sequence:KEGG:Bpro_1344"
FT                   /protein_id="ADU34714.1"
FT                   /translation="MKRLPLFFLALLASALTRAEWLTLSGTPGDATGSYVQVDPARIEV
FT                   DGARRGVTLRMSLAQDFTGKDGFKLRSFEARVTVDCEARTARYVSATYYGLPNFVGQPV
FT                   AIKQFEDDDIRPMTLPGAPPELAARTVNAACNVGAK"
     atgaaacgac tcccgctgtt cttcctcgcc ctgctcgcct ctgcgctcac gcgggccgaa        60
     tggctgaccc tgagcggcac gcccggcgat gccaccggca gctacgtgca ggtcgatccg       120
     gcgcgcatcg aggtcgacgg cgcgcgccgc ggcgtgaccc tgcgcatgag cctcgcgcag       180
     gacttcaccg gcaaggacgg cttcaagctg cgctccttcg aagccagggt caccgtcgac       240
     tgcgaggcgc gcaccgcacg ctatgtgagc gccacctact acggcctgcc gaacttcgtc       300
     ggccagcccg tggcgatcaa gcagttcgag gacgacgaca tccgccccat gacgctgccc       360
     ggcgccccgc ccgagctggc cgcgcgcacg gtcaacgcgg cctgcaatgt cggcgccaaa       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page