(data stored in ACNUC1104 zone)

EMBL: CP002417.PE492

CP002417.PE492       Location/Qualifiers
FT   CDS_pept        532654..533088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0493"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: vap:Vapar_0474 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34715"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4G9"
FT                   /inference="similar to AA sequence:KEGG:Vapar_0474"
FT                   /protein_id="ADU34715.1"
FT                   /translation="MTLPQETGLVVIDTNIALDLLVFDNPDCLPLAAALASGALRWIAT
FT                   APMRTELARVLGYPLIARRLAQREMEATRVLEAFDARVSLLTDTPPRAPCVCKDPDDQV
FT                   FIDLAVAQRARLFSKDQAVLTMRKRLAAQGVVVATVLAAA"
     atgactcttc ctcaagaaac cggccttgtc gtcatcgaca ccaacatcgc gctcgacctg        60
     ctcgtgttcg acaaccccga ctgcctgccg ctcgcggcgg cgctcgcatc cggcgcgctg       120
     cgctggatcg ccaccgcgcc gatgcgcacc gaactcgcac gggtgctcgg ctatccgctg       180
     atcgcgcggc ggctggccca gcgggagatg gaagcaaccc gcgtgctcga agccttcgat       240
     gcccgcgtga gccttttgac cgacacgccg ccgcgcgcgc cctgcgtgtg caaggatccc       300
     gacgaccagg tcttcatcga cctcgcggtg gcgcaacgcg cgcgcctctt cagcaaggac       360
     caggcggtgc tgacgatgcg caaacgtttg gctgcgcaag gcgtggtcgt ggcgacggtg       420
     ctggccgctg cctga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page