(data stored in SCRATCH zone)

EMBL: CP002417.PE493

CP002417.PE493       Location/Qualifiers
FT   CDS_pept        533447..534385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0494"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="KEGG: lch:Lcho_0133 AraC family transcriptional
FT                   regulator; PFAM: helix-turn-helix- domain containing
FT                   protein AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34716"
FT                   /db_xref="GOA:E6V4H0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H0"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADU34716.1"
FT                   /translation="MTSSSQRSPRQLLPEVEVERSRSTELGYEPSTEVGLVRCLEHGFP
FT                   TPLARWHCHEEYELHLIVATSGQAFVGDWIGAFEPGHLVLCGPKLPHNWISLDMPAEGV
FT                   PQRDLVIQFLHDPIFEAAQRIPELQEAVRMLERARYGIEFFGMSASAEAHWHRVKDARG
FT                   LKRFSLFCDFLADMAMCTDYRLLSGMQTDGDHGIEAINDVVTRITNEPAKDISAADIAA
FT                   ELGMNPGRFGRLFRRATGHSFLGYVNEVRINKACLLLMQSDRYVTSICYEVGFNNVSNF
FT                   NRRFLEIKGVTPTEFRRQSQLRFEGAGSLEN"
     atgacgagtt ccagccaacg atccccgcgt caactgctcc ccgaagtgga ggtcgagcgc        60
     agccgctcta ccgagctcgg ctacgagcca tcgaccgagg tggggctggt gcgttgcctc       120
     gagcacggct ttccgacgcc gctcgcgcgc tggcattgcc atgaggaata cgagctgcac       180
     ctgatcgtcg ccacctcggg ccaggccttc gtgggcgact ggatcggcgc cttcgagccg       240
     ggccacctcg tgctgtgcgg cccgaagctg ccgcacaact ggatctcgct cgacatgcct       300
     gcggagggcg tgccgcagcg cgacctggtg atccagtttt tgcacgaccc gatcttcgaa       360
     gcggcccagc gcattcccga actgcaggag gcggtgcgca tgctggagcg cgcgcgctac       420
     ggcatcgagt tcttcggcat gtcggccagc gccgaggcgc actggcaccg cgtgaaggac       480
     gcgcgcggcc tcaagcgctt cagcctgttc tgcgactttc tcgccgacat ggcgatgtgc       540
     accgactacc gcctcttgtc gggcatgcag accgacggcg accacggcat cgaggccatc       600
     aacgacgtgg tcacgcgcat caccaacgag cccgcaaaag acatcagcgc ggccgacatc       660
     gcggccgagc tcggcatgaa cccggggcgc ttcggccggc tcttccggcg cgccaccggc       720
     cacagttttc tgggctacgt gaacgaggtg cgcatcaaca aggcgtgcct tctcctgatg       780
     cagagcgacc gctacgtgac ctcgatttgt tacgaagttg gttttaacaa cgtctcgaat       840
     ttcaatcgcc gatttctcga gatcaaaggc gtgacgccga ccgaatttcg caggcaaagc       900
     cagcttcgtt tcgaaggcgc gggcagtttg gagaactaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page