(data stored in ACNUC1104 zone)

EMBL: CP002417.PE498

CP002417.PE498       Location/Qualifiers
FT   CDS_pept        538520..538732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_4343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34721"
FT                   /db_xref="GOA:E6V4H5"
FT                   /db_xref="UniProtKB/TrEMBL:E6V4H5"
FT                   /inference="similar to AA sequence:KEGG:Bphy_4343"
FT                   /protein_id="ADU34721.1"
FT                   /translation="MRSRRPPRPRSSSRRTQRGQVITEYVIVAGILAVMLFATFPGADR
FT                   SVVALLIKAFRDAWSTYSYTLSYPL"
     atgcgttcac gtcgtccacc tcgcccacgt tcttcttccc gccgcaccca gcgcggccag        60
     gtcatcaccg aatacgtgat cgtcgccggc atcctggccg tgatgctgtt cgccaccttc       120
     ccgggcgccg accgctcggt ggtcgcgctg ctcatcaagg ccttccgcga tgcctggtcg       180
     acctactcgt acaccctttc ctatcctttg tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page