(data stored in ACNUC1104 zone)

EMBL: CP002417.PE50

CP002417.PE50        Location/Qualifiers
FT   CDS_pept        52422..54380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Varpa_0050"
FT                   /product="glucose inhibited division protein A"
FT                   /note="KEGG: vap:Vapar_0045 tRNA uridine
FT                   5-carboxymethylaminomethyl modification enzyme GidA;
FT                   TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Varpa_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADU34273"
FT                   /db_xref="GOA:E6UXS9"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6UXS9"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ADU34273.1"
FT                   /translation="MLYPEEFDVIVVGGGHAGTEAALAAARMGAKTLLLSHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLY
FT                   KAAIRHRLENQPNLSLFQQAVDDLMVEGDRVVGAVTQVGIAFRARTVVLTAGTFLDGRI
FT                   HVGLDNYQAGRAGDPPAISLSARLKELKLPQGRLKTGTPPRLDGRSIDFSKCTEQPGDG
FT                   MPGGAGPMPVFSFMGRADMHPRQMACWITHTNARTHDIIRSGFDRSPMFTGKIDGVGPR
FT                   YCPSVEDKINRFADKESHQIFLEPEGLTTNEYYPNGISTSLPFDIQYQLVRSMPGLENA
FT                   HILRPGYAIEYDYFDPRELKSSFETRSVKGLFFAGQINGTTGYEEAAAQGLFAGINAAL
FT                   QCRGEDAWLPRRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTEAG
FT                   RKLGLVDDARWDAFSRKRDAVSRETERLKSIWVNPRNLPAAESERVLGKAIEHEYNLAD
FT                   LLRRPDVNYETLMSLDGGKYSASSALSETEIEQIEISAKYSGYIERQHDEVERAAHFEN
FT                   LRLPADFDYGQVKALSFEVRQKLDKHRPETLGLASRISGVTPAAISLLMIHLRKGGHKA
FT                   FARDAATEAAAEPQSAE"
     atgctgtacc ccgaagaatt cgatgtgatc gtcgtcggcg gtggccatgc cggcaccgaa        60
     gccgcgctcg ccgccgcgcg catgggcgcc aagacgctgc tgctctccca caacatcgag       120
     acgctggggc agatgagctg caacccgtcg atcggcggca tcggcaaggg acacctcgtg       180
     aaagaggtcg atgcgctcgg cggtgcgatg gcgattgcca ccgacgaagc cggcatccag       240
     ttccgcattc tcaattcgag caaaggaccg gcggtgcgcg cgacccgcgc ccaggccgac       300
     cgcgtgctgt acaaggccgc gattcgccat cgcctcgaga accagccgaa tctcagcctc       360
     tttcagcaag cggtcgacga cctgatggtg gagggcgatc gcgtggtcgg cgccgtcacc       420
     caggtgggca tcgctttccg cgctcgcacc gtggtgctga cggcgggcac tttcctcgat       480
     ggccgcatcc acgtcggcct cgacaactac caggccggac gcgccggtga cccgccggcg       540
     atcagcctgt cggcgcgcct gaaggaattg aagctgccgc aaggccggct caagaccggc       600
     acgccgccgc ggctcgatgg ccgcagcatc gacttttcga agtgcaccga acaacccggc       660
     gacggcatgc cgggtggggc agggccgatg cctgtgttca gcttcatggg ccgtgccgac       720
     atgcatccgc gccagatggc ctgctggatc acccatacca acgcgcgcac ccacgacatt       780
     attcgctccg gcttcgaccg cagcccgatg ttcaccggca agatcgacgg cgtcgggccg       840
     cgctactgcc cgagcgtcga ggacaagatc aaccgctttg ccgacaagga aagccaccag       900
     atctttctcg agcccgaagg cctgacgacc aacgagtact acccgaatgg gatctcgacc       960
     agcctgccat tcgacatcca gtaccaactg gtgcgctcga tgcccgggct ggagaacgcg      1020
     cacatcctgc ggccaggcta tgcgatcgag tacgactact tcgatccacg cgaactcaag      1080
     agcagcttcg agacccgctc ggtgaagggc ctgttcttcg ccgggcagat caatggcaca      1140
     accggctacg aagaagctgc ggcccaaggc ttgtttgccg gtatcaatgc cgcactgcaa      1200
     tgccgtggag aagacgcctg gctgccgcgc cgcgacgaag cctatctggg cgtgctggtc      1260
     gatgacctga ttaccaaggg tgtgaccgag ccgtaccgca tgttcaccag ccgcgccgag      1320
     ttccggcttc agctgcgcga ggacaacgcc gacatgcgcc tgaccgaagc agggcgcaag      1380
     ctggggctgg tggacgatgc gcgctgggat gctttcagcc gaaagcgcga cgctgtttca      1440
     cgtgaaacag agcggctcaa gtcgatctgg gtgaacccgc gcaacctgcc agccgccgag      1500
     tccgagcgcg tgctgggcaa ggccatcgag cacgaataca acctggccga ccttctgcgc      1560
     cggcccgatg tgaactacga aacactgatg tcgctggacg gcgggaagta cagcgccagt      1620
     tcggcactga gcgaaaccga gatcgaacag atcgagatct ctgccaagta ctccggctac      1680
     atcgagcgcc agcatgacga ggtggagcgc gccgctcact tcgaaaacct gcgtctgcct      1740
     gcggatttcg actatgggca agtcaaggca ttgagcttcg aagtgcgcca gaagctggac      1800
     aagcatcgcc ccgaaacgct gggcttggcc tcgcgcattt ccggtgtgac gcccgcggcc      1860
     atctcgcttt tgatgatcca tttacgcaag ggcgggcaca aagccttcgc ccgtgacgcc      1920
     gccacggaag cagccgccga gccgcagtcc gccgaatga                             1959
//

If you have problems or comments...

PBIL Back to PBIL home page